(navigation image)
Home American Libraries | Canadian Libraries | Universal Library | Community Texts | Project Gutenberg | Children's Library | Biodiversity Heritage Library | Additional Collections
Search: Advanced Search
Anonymous User (login or join us)
Upload
See other formats

Full text of "Your Computer"

Ltanma'k 

FraiCe 

Germany 

Greece 

Hoi and 

Italy 

New Zeala r.d 

Singapore 

Spain 

Switzerland 



3&00 

52.SQ 
9 50 

310.00 
8.90 
4300 
3.70 
7.Z0 

JQC.00 
7.50 




MARCH 1985 



BRITAIN'S BtGGE 



I *M : W h' 



Take me to 
your micro 



Spectrum Sec 
Speed Basic and T 
Supersprite CBM-64 
and Amstrad Artist 

~ ic Creep Castle 
and Dragon Wordp 
BBC Bells and f 




PUTER MAGAZINE 



Vol. 5 No. 3 



- 







# 






enry House, Canning Place, Liverpool LI 8JB Tel: 05 



J 




A-ews — ComTioJors 128: page 21. 




Fobot competition: page 5i. 








Cow story - Robots: page 52. 




20 



NEWS: >"irst pis of Comraodirc 128 md Atari ST-and XE, Rocky Honor hits 
Spectrum,. 0;k wobbki Quick disc, software through y:»ur lelcvhlon 



^CLETTERS: Sa;e he Diagi-n, magic a Q FIRST BVTES: \vhai is CP/M and 
bul'ulc probnps knights, bill 



J Poke probnes knights. 

aOCOMP'JTE 11 CLUB: Pan! Rend 

OOhas ei harrowing experience. 



35 



l low tin micwi store dads' 

HARDWARE HIT LIST; fenman 
and i he t >ric mocem. 



37 



SOFTWARE SHORTLIST; Latest commercial sofivatt rebates — wizards vsrsvs 
lizards, choppers versus brick walls, coal-stealing mdes versus prison wardtrs 



rShaima's mammoth space tame. 



/■CQltEST CORNER: Hup North /■ G CI1M-S4 SPACE JUNK; Nairn 
T%Jreviews adventure £ameS< ^U' 

51 



WIN A £110(1 ROBOT COMPETITION: Last year we got you to design your dream 
or T iig!ttmare micro — this year creuc /our own Iron Man He a Frankenstein. 



52 



RULE OF THE ROBOTS — TAKE, ME TO YOUR MICRO: investigates The 
current market for cheap domestic rohots linked to horcc computers. 



57 



7X-RI MAD JUMP: Fr^drik fuarEon's conveyor belt to hell. Don't bnr.lt 
your head or fall through the gaps in the mlk-ree aster of micro fLti . 



59 



Sl'liCTHUM TERRAPIN t High twolutbri mwcrncTT, colour, vound, graphics — kn 
Collier sets cut to save teiroriscd terrapins without turning turtle. 



65 
71 



BBC AND ELECTRON BEL1,S: It's for yoo-iioo, Esmeralda, Quasimodo has a chip 
on his shoulder but Bryan Lewis has a great game for both Electror and BBC computers. 

SUPhKSI'Kli'fc UHM-G4: Lira ham Barbour's program iuni Lcdcpenden ly of Basic 
and piovides all the sprite editing ficilities you could possibly want. 



"7TATMOS CREEP CASTLE: Grotesque graphics, awesome jound. You wont lire of 
i / Miles Dunlco's new game — twdvt screens and stacks of platforms. 

DRAGON WORDPROF: Full auto repeat on keys, SCCrM four svpaiatc 6 1 Htha meter 
lites, and Tits into only 2K. Simon Tully's wc-rd processor for the D*32. 



82 
85 
90 



ALL ABOLT ADE — AND BCPL: John Dawson initiates yoi: into the rites of 

two high-level languages, 

AMSTRAD ARTISTS ONLY: Wai Tsang Splfflhej aul on adrtwiag prolan for the 
Amsind. Offers line drawing, circle plotting and airbrush facilities. 



92 
97 



SPEEDING UP BASIC: Ki^hard Tayio.' lashes out at slow Spectrum Basic. 
Totally user transparent and will work with all Spectrum Basic programs. 

TELSOF1': Every nonth at leas: two ol'Thi main programs published in Yottr Cotnpuitr 

i<* rvailahk* (fciwfi yttitr Tplfphmw Mm* This mnnih h's RRC RplkarH ZX S^.-Lii-iliUi 



98 



I EXTEND ED VIC BASIC: David Redmond teaches the Vic-2C more words 

d gives dmriufiKl rJt ten*. 

| rinSPLCFRUM SECURIF1LE: A flexible nadjaoe cwk da a t.andlLng program will 



tbe developed illusinuir.g uany of the points ciseussed i.i this article by Job Ellis. 



106 



110 



INVISIBLE ZX-81 TOOLKIT: 

Stuan Clarke peps M]) the ZK-81, 



BBC DISC OVERLAYS 

Andrews solves a space dilemma. 

1 1 A** L rtJTOR: Mof,: tWttR assembly language for the Sinclair QL, courtesy of 



Thii llollida) — not fotge:ting a brief intmduciitn tr> QDQS. 



14 "J FALL GUY COMPETITION WINNERS: h Yput Comtmur reader C oes to 
I m Hollywood, Don't forget about this month's grca rot-Hit compel it ion, either. 
_ 



RF.KPON&F. FRAME; Tim 

IJfl.'tndl replies to teadeni" qnerijis. 



1t\ | SOFTWARE FILE: T^.i pag*a 
C I of software fo* most micros. 



130 



INDEXi Continued frorr last 
month. 



146 



DATIiUASlii FquI Hond ixttnda 
up nicto events. 



YOUR COMPUTER, MARCH 1985 3 




TTiat old villain sheriff Boss Hogg is up to his ticks again. The Dikes still owe him $5,00C which thev 
borrowed to buy some new farm machinery Sheriff Hogg warts the money repaid, and he's told the 
Dukes that unless they pav up in 72 hours he'll seize the General Lee as collateral. Bo and Luke have come 
up with the idea of entering the annual Hezzard County Cross Country Read Race - First prize $5 r 000 r 
which starts tomorrow. Normally the Duke boys would have a good chance of winning but with the 
ent're Hazzard tniinry Police Force arid Boss Hogg revving up to stop them, new they're not so sjre. 



E 



■ • — 



H 



■■— > 




Every single elite' product carries the unique £LHe: 
Hologra phic sticker. Make sure your copy does, it's your 
guarantee of quality 



Mail Order: Just send a cheque or P.O. payable to 
'ELITE' Dr quote your visa card number 




Elite systems Ltd 55 Bradford Street, Walsall, England WS1 3QD Telephone (0922 6'12"5. Telex 335622 spetel 3 ^ttenton: Elite 



The ZX Spectrum 
Expansion System. Only £99' 95 

Sinclair's complete 
alternative to 



fl 



t • it 



y discs . . . 



=sr* 



ssr 






^ 







-^ 













The ZX Spectrum i 


mm 


R. |k \ \ 


Expansion System contains: 


\/ 


Ik IL ■ 3w iH 


• On* ~f.H Mknxlwe 






• On* ZXI interface 1 




'& \ % 


• Ort? wiSlefc :ontaini. ig bur 




% V V ^ 


programs, on Microdrive earrktge 




k'H f%L ^~^ 


•Afltfrodrive durronslialion cartridge 




H\ » B 


• OiK lilurtk Micndmr dilutive 




WW\ W 


• Full (Joturnenlir ran 




THhi™^"- ^ 


• COnnvclinglead tfirMio-oclfive/ 






Interface 1 




& i \a^ 


•ZXrJetJsnH 






The new ZX Spectrum + 




Fufy ccmjwrt.ibl? wih it Stedrurn 




^^^ 


wiftwareard peripheral, including _* 


^^ 




lhi< Expansion System ^^^^ 








Tasword Two word processor 
Tuns fomlXSp&irum Inioahtgh-qmiityword 

pruceiw>rl 

Tdswud Tnu I ids dl liieesaeriLal FtaLuits uf 
prnfewioml wnrrt pror filing packages- nwe nnrd 
crpy, hsert, margin setting r hc!p' prigR, f^rri rind 
r«pliio.'.aTiiJ rTuthrno'e. 
Written bjf Taimafi Soiware Lid. 
Uiiialpfi«(RRPj:ei3M. 

Masterfile filing system 

Ad d Fin I i:ii . . . pc nu net tiki . . . itock in vt ntorics. . . 
5ljmp ordburn collec.ions...dub reco _ ds. recipes 
.. .# you can fife It, tou can Maiterf Je ill 

Mfljrte-filcii a (nenu-dftwer filing and rtthe/al 
■".ysten of rumens: pewer Display farnatsjrciiscr- 
defuxd w the range d apploliofls iserroimojs. 
WritUri bv CdjriplJfUSyifUrJii mi 
U,uiilprir.d(RRf > >:£l6.95. 



: 






i ' '. — i t, i . i . Hi" i . . i . f " i ' j 



Games Designer 

Now, all you fleet to iridic oriprrul games 4rc 
a i:.i:ictl iicai-iindCiama Dtiigrcrid has fight, 

VEiy diile cut jjj t*pi L^mri iiiinJgjn ies lutyuu lu 
play as they are -or mndiy out of M rsrognitioni 

lherrt mw.rMr<C brsnsn easirr, monemjov- 
rtbk - , w#y inly ^africs. Jfii^n 
Written ty Quicteilwi Ltd 
Uiual price tfcl*P)f.l-: 35. 



.... 


... 




•■ 








L| M UIH 




-,.., 


HI 
















■ 

Ulll 


- ■ 










rn'J 


11 • 


- ■ 















.. 



jii--i^rrn i =n 






1 Ant Attack 

The 4ll< lime ilaaim 30 iUilcg, game. Ant Attack 
combines slLfinnig Esche -lilt* graphics with fjst- 
rDvng actiDi ard a real uitfcol challenge. 

Ysur task i* ti: enter the willed <al*; ittk «ul 
yourcapiurcrf pa"tnc; dn J cstd.pt. At J Urnsyot 
can choose from tour an$ra d view. Eul beware: 
LsvtlybpiilHriiMiUy^fflHaiik ._ 
^ Written by Quidflilv£ Ltd. Lteual price IRKP): 1 6*. 




/^pra J ?i r t 7frj"uf?orta^Sft'S^«tfiiwcrS^eflf'jH7)+, Rsanrrttinded re&f prfi& are toteach program on oueffc 



. . . includes this 
great set of 



Microdrive programs! 




> 



The unique ZX Microdrive system sets 
the Spectrum aoart from all other 
home computers. 

It gives you all the advantages of 
floppy disc drives - at a fraction of the 
cost. And :ests show the Microd rives 
are (aster than iornedlic drives. 
Now, the complete Microdrive 
system comes in one package - 
together with four of the 
best-ever Spectrum 
programs, on Microdrive 
cartricges. 

This softwa'e alone would 
normally cost you over £50. 
Yet the Sinclair price for 
the complete ZX Spectum 
Expansion Pack is just £99.95! 
YojII find lull details of its contents 
in the panel opposite 

ZX Microdrives-another Sinclair first! 
The ZX Microdrive is a revolu:ionary 
fast access /mass storage device. And 
it's the only truly affordable aternative 
to disc drives ... 
•Loads or saves up to 85K of 
program or data from Microdrive 
cartridges. 




•Just 35 seconds to access a typical file. 

• Only 9 seconds to load a typical 
4SK program. 

The ZX Microdrive cartridge - a 
unique storage medium. 

Smaller than a matchbox the ZX 
Microdrive cartridge packs in a mass- 
ive amount of data and programs. 

Each Microdrive cartricge holds 
at least 85K byte of data or prog- 
rams (mats 30 pages of A4 text). And 
vol can store up to 50 different data 
files per cartridge, identified bytites 
of your choice. 

Every cartridge ccmes in its own 
protective case. Simply remove the 
cartridge, slot i: irto the Micodrive, 
anc it's ready to use 

ZX Interface 1-adds powerful new 
capabilities to your Spectrum. 

ZX interface 1 connects to the back of 
your Spectrum and controls up to 8 
Microd rives. (Additional Mi crcd rives 
are available for £49.95 each.) 
It also gives you: 

•An RS 232 interface -to link your 
Spectrum with full-size printers, other 



computers using RS 232 itha industry 
standard interface) and provide data 
transmission over telephone lines, via 

modems. 

• ^X Net- lets you setup a local area 
network of up to 64 Spectrums, for 
high-SDeed data communications bet- 
ween you and Spectrum-owning 
friends. 

At your local Sinclair stockist-today! 

The ZX Spectrum Expansion System 
ades an exciting new dimension to 
Spectrum and Specrum + computing. 
At £99.95 it's superb value too. 

To find out more t ca I in at your 
local Sinclair stoedst now! 



Sinclair Research Ltd, 
Carnberiey (0276) 685311. 



<■,<. ;>. s r .r.-nnv fX.v, rnjdi * D fit I Iff 
ZXIn&lfaurdrc WdtlirMijiliotiilithK ftoctlth Jb£ 



inrf 





MATCH DAY 

SPECTRUM48k 

7-95 







SPECTRUM 4Sk 

6*90 

COMMODORE 64 



~g*w 



-..-7.; s 




_. Ocean Software 

Ocean House * 6 Central Street * Manchester M2 5NS Telephone 06 1 832 6633 




you 
II the 
action 




rt 



V' 



w 




Vft 



!r~i 



-/ 





SPECTRUM48k 

6-90 

COMMODORE 64 



DALEY THOMPSON S 



7K«fiTiy7Tr: 



SPECTRUM48k 




COMMODORE 64 



Ocean Software is available from selected branches of: 

WO€JLWG9ttH. WHSMITH,(^/^5ffiE2^ H LASKTTS, Rumbelows, 

Spectrum Shops and all good software dealers. Trade eitquh ies welcome. 




a 

K 




aBfmm^mm 



1 1 : we you eve t ne ec.e d i ic w ty res 
when you were flat broke? 

Or a new battery when your 
spending power was exhausted? 

It's a problem when you haven't 
got a BaicJaycard 

Suppose, fcr example, you 
suddenly have to spend £.00 ro get 
vjur car through its MOT at a time 
when your bank account is scaxcly 
in the black. 

With a 3arclavcard von could 
get your car on the mad straight 
away, sensibly deterring payment bo 
in i:i with your income. It's nothing 
more than intelligent budgeting. 

Of course, a Barclaycard's 
influence goes beyond coping with 
car expenses and dealing with the 
unexpected. 

It can je used wherever you see 
the Baickycaid-Visa tign, to pay For 
countbss goods and services. 



You can even use a Barclaycard 
abroad just as easily as you can at 
honx 1 . It's welcome at over 4 million 
pl ices in 16U countries. 

I lore's how _t works. 

You simply prosen: your 
Barclaycard an.i sign a voucher tach 
time you make a purchase. 

Each month you'JI receive :i 
statement showing details of every 
cramac:ion. the total ainoant out- 
standing, he minimum amount yon 
must repay and rhe care by which 
your repayment must teach us. 

And you can re jay in any ef 
tliree ways. 

You coulc choose toscttle in hill 
w.tliin 25 days of the statement date 
aixl no interest will be payable at ail. 

(Which meins you ecu lei have 
had up to 7 weeks free credit from 
ths date you made your purchase.) 
Or you could pay just the minimum 



which is $% ot your statement total 
(minimum .£5).Ot> thirdly, you could 

pay any anxnmtyou wished between 
the mininuun and the Kill amount 

It yon rake extended credit, 
interest is calculated on u <lailv basis at 
die rate ol 1,75% |xr momh 'current 
at 1st January 9H5>). This is equiv- 
alent to an arLitnl rate ot c harge o\ 
23.1':'- tor \ uirch a s e s an^. _ty | >call y. 
23.f>'K for Cash Advance* , jm wliicli 
an additional handling charge is 
made. Tlie monthly interest :at: and 
handling charge may be varied at 
any time. 

In practice, the rate would 
almost certainly Ik- less. 

Say you used your Barclaycarrl 
for your ^103 MOT repirs two 
weeks before your statement date and 
paid oft the cost in four equal 
amounts, each one being received by 
us 15 days after each statement date. 



BARCLAYCARD 



17SA 



Application 



You would have paid tota! 
interest charges of about^325 which 
works out at 16.9% per annum. 

If you'd like a Daiclaycard and 
you're over 18, fill in the application. 
There's ik) joining fee or annual 
subscription. 

Once youVe used your 
Barclaycard you'll wonder how you 
ever managed without on* ■. 

\bu don't have to bank 
at Barclays to have a Barclaycard. 



BARCLAYCARD 




t£*srmt: 



Pott tow completed appall ion to: NH, 2000. 
B3rcUycjrd.DepaitmfiitSJ56, FREEPQST, 
Km: i lojnpujii NN1 lYG.Nc scaup nc;<ted. 



t l '.HI OGUrltl E * fcK^CtnHS *C t^» Mf<t *HH3HKIU05 H31 ue 

5*PC^Li\S 



L^rimrN«kd*d*Tt,. 1*0 hG <ta*C %D CT*pfe„ 



4. Ma 1 tern*. 

hni Tinarf _ bvn XIIp 

DlMaVoa V*)iw (■*■* I hmMU LMdniihrtU rirfmU 



Sjirjri 



J" J prttnl «rmln »*iTWr« ir*->(»-r iin* lekhtl 



* • ■ 



'JmrtSrifLnt 



, .... ■ ■ : 



' ■■ ' ' 
wo, 



1 ■— ■ — ■ 



- ■ - B ' ' ' * h 



I Cm* 

L llllll***'* 



k _i ' ■ i j. .. J i ' 



ErrxitxriulnM* 



"il'i 

—k i . 

f:u*rp 



... .... 



7 tour i*ior»nntiui imi ttif jtani nu«4L*r, 
I DttiCJirlh"Ki'M:-nt1 **i 



-*n* 1*:*+*** k pj ! *.k»*i ( 3t5* i«i*'l 



bi | * W l tf l *H *M ■'pcLWgSrDiflhL 



1 *wiffl(*iii*» 



r-ury 



ftpranodAni 



»r.tsilj <mhkIi««! .1 IwtuC !;■*** £•■■■»■ O 
ahtV»twiiWrtwi__ 



T imimmw 

[UHvx'JIUviMlJHi U Us.D UiO V:D 



^Mfi ptibs". 



*"**""™ rt ■**■>*' * mm m*Ptt 



if l-j- Li vtl nl r.\y anti 11 tnWfcM'JC" ■ ' * 1= tvip 



S»fiir(ibfld. fh, . ^f i M pu. •>'*• bnt- 



..-..,.^1 II I" 1 M'J 



f <*»>lij> . StliJUtf * M ih UlKp-f 1 is bll 1 m in™ .nun ■ iff rii Cjn»!bt yd 
jp'titutJ Ktffl otd agrir tote hub fey It BtwkxadCcMAenutlbhis m tut 

L|Auiilp<inHiMH) Ear 



' l'i'. Kit II t^. L1 S ' ' ,J ~ 



1 . 
1 




11: 




'I' 




■-- 








- 


369 








•1 . .1 


■1 




!!»■ 


■ 




1 




u 


|tM> 




n 


^u 




' 


«*#* 






















in 






■ 


M 









































BWCl^''"i&lJ*Fir.Pr E i-|<TrrirWiajr^iii,-S • «r^ P. 1 |-;,V.m:7 ^^ ..;Hn;f r rtLr-nMrii SitH.iwUsi i£l 
fi.1< i ^ii mmtiWrUi wIa iiijn ly 'J-f ?CCJ BltiUlfti't. But* mmi S.3fl.rsfrTr,;T. H3nh*ir3i-)r Piihj 11 j t|; i,-|Fit 



Barclaycard Conditions of Use 



l-«uMrtT»|tt<l*WQrt*M*«**1»'WlTtl*lw.ll-.rie:nri:ili»UM 

I a ■i^tCJMaaflr*Tfc*li^r^i^a*l»ii , li^^'fctf f ^^tK^r, ' i *^ i f 'H 1*1,^1^^*1^ 
"i»t FalimKlRurlr lUolV; 1 Irtuta ">■ *i i n ' T*tn* »wwK iKr- 
m •» n*o» »*up)» *^bT nBpi MMotftMH menwef com » 

lfc lie mHJgrlf irx n^f me j firl jrJ WjiM u imili * ^u - 1*****/ *■ 

#nnr HnAuri jxnrl nairlaiiivi 

? Ihr uciti zN'^'iwrf rt»f JfhtVi wl^^wmw. i mtlHH KlilHKI 

II iv wm {? ~.» »)*■ v'*~ r«ir M.* »*i» wevHvM Mnt a*.m«oi m» 

; 1*11 Irtl * in ITl.-li-rull'fVJT* i'l'i-jH tMUMH » VCH*. Mivt fdJI Ml 
UW^jr UnMo ■ up ^aJ;. ™un-t, (« S». n in*(l a M£v4 

) ti»ldih<ii*U ^f ;3j.':..ir.TI1nii>it»Hrt 1 |j.j-H (U ,,i 1 fc^K*rt!i'*« 

..' lOllffl "IV JT'LlLiJ Ll^'l^ *l* IMir U'C 1C IJih l.i ■ r KiV Jl jBflAHdMM 

A -r:' r -un^a!AM>^isli aaara otrr ft mwd t> i i'jid - , k^v 1 
i The ia-*. ri ivi-jlr iwd imWliv ****-!»ir 1,i *» ,■ ■ n^l (.rfOaV w^«l pp ii 
r 1 .-:-^- Iwmnnji! lihfirfir i-,'i^ ■' llwsL^,i>--l lit 4 ikjr v U11- U 1 ^ a*** i'Srj^rtiw 
oat-BillwajiBimljl tojdl ? HnJHTJl»l>Biii- 
!■ mil' ipUm**! 6a ll*fil lii rX*i Urn /. I « ul»;C I rt", ^1 »r«c a |h- iVuW:* th 1 h 

K^*ijjl»TiiV|ili, lilliTi^il|l||ru-l.a!iii,- 1 : n liin!-..iT i-fl H I -i 1 1 — .. l ~i 

* vu'l ^■■iT-^'Ml!' Cup* rwiiLrti tto'iri*'!* n- vd wtkfWf itk *hei P< 
rbrrjlr UM^p.-diiftii rllimlb* iliM^dPSIM^jfl* I ' 
;i P tv*rj*r. \m trv. 0* lh> hiLjirr *h . i-y fc -jt-^ncfliM 



hy BwuJB " ■ijjJJi ii:ig j »n bv.'h 'IN ilr. lift Civil 4Bfrii>wrwl it*!l Ihii ■:"! 

CilOll I 3<V 3#>lj iF^nbf-A-ti j' I > >ih| *•!■■■■ .'Jy^ li-|, !'■ dn'« lun.Jli It'iilL-M 

sl lw lm ci T-ai y 1- 1 :jfd Jnj'cr JkUiH Y r* t"H Hit eth.lv Umm** MK W mm .11 

»W t mi JUiflK>H*3 .'iJlllHllV, tK mr.1 It T I'm K". *!* " ■ rH 'Jll Tr 
MtC iJ>1Mr-.iJii'Jtl(l«J,n,iKi;i ^>.pr II In Km b(-W C#K' V 1" 1 w " *"/ 
tl«»um;( ■"•- c bXvji J li»Fh H SfUCB aTTwrr! ,t.b'. I, , , .1 1 I 
*l'4fhMI •* iUu. laLph^ vihLHV rita Lv'k * n*^HHHin1^*tl«l IPWIimnil 

■afii>:rlfTnd Lsict kul n linmjr fn MX MtU« an hkm** en S 

MUhi»'.rf:c.i-rT.AJl 

t. I * j»h ujfi ! ntil a *« n r\vd<l 1 (jV kv— ;fc>»-^ Jr. _ii -*3t s t* 

U< mvl hf au Hon h> lii « J tfcfi tm'-n ** WU4 «uCV ta* M Mfilpr 

■ ■Mii^pviyhii 1; — "T -H'''i'"'1V* " i ~ jlL-M fi a h~i J-ll iim Ii T iElifc-j'R 

cj*txr Fi)Wli||< *:■■«• «J X cjfttr 11 NUH -<^ jn> tv > uH U lp <|J J Pr 
MlMi -J, v •* wi*i 1 1> 1* <■ o imp ;ur- 1**11 Rli* 



L 'Pbid Ef ft cJou tf ^ env' 
Lr-riiM3- lul U7i;r 
ibl lludit zkuLff ■*!■■•■. onWf « 

A lip^wMunnjMri ■. 1 
M ca ?* IUAriii<r . r- ii-.i- 'i.-u. 



1 i DM Lilr vrlPMil > 



in .1 *t«™ r-ni 
I lidfeirJ to *» l*IM»* .TVE»t k> •**&! 



m 

pi 

> 



X 



« (■**•<■' CI ■>»' <**}l*l r. k P*&-H*tri*4 I r« r 1 j j, D-Mh ri ln-Jt 
nwnlmoCi y IH lis' X ittHinl wl -j* ■<*.m T *U *» U*0*t a 

Hi»r jt-^-t.» 1.1- I Cl> lu<iiqriil,il» M frVhtUWCVm « *^ 

tnihlntn to-ri; l<>«ii'ililih J»d>> ,*-IU*4-tiXnX*Kltt*l.- »fl 

KcfirioiElElinuithiucfeaiK li>mi«»ili,»ljii'iT**»iVpT»l> KKIflN'* 
Uir, 'H<**nfnciart~HMCii„ut< ,yf , In.i,, ..*, emi^.Kiiij.') 4|tp!> 
*ii** •■mi •* rtu r> -iv 1 jk .. . n-.Uii««' -iv^ s»**an«fl*liiii 

»lw. I. . 1WIMT hl4^.. w I 

SKvrri' "1 ^Wrj IV It-.-* j"i^r<.i ipj M"* ^mvw w »»HV - o( t« vft <■ «^ 

Wd l«F BI irf ■ M LP« 1 mi W **•!» * I* ■« * <KtW! k JPl V4l*B«d 



li. -,.1 .1.1 -. I - „L*r to -11 1 llinj^ n r<( SorniHl t»m«t»i. 

*Wi ; ii *-w1b lUh 1^ cinj is t^**>W*%a*/l * if t*fiM i»*Pm< ertv 

^n>ijiii^>3ci W t-j: ii: _ uv If- -,'-', ^i>¥n miv^hil S.**^l*#«*«,*«i Pk.*ai.L— I 
8in- :tiH|a mo- faipfj^ j bSjn-: li I- Ih* _' hvJM'ygwn 'hicv^C ?* ^lfmri Eiuvt ■■ 

1i« :ndK'tfr»ilajiiTrLr» 4 ,i,,|l, *rt*l» ^ H b*V«. 

tl UTlKHfT -I I.- -i,-r»'f Hum-it- »■ |i- Ihr 1J1I ■ J P"*f fll hw *fl^T fl( !■ rn^i 1 

1'jUiCMatnHiH iilIi iw a: 1 thrjjr In inartMiim jwj»|( 14/1"! mm' iwn»i» 
- ■*. n-,,1 in. buJi iva-nlpri I'rj.rr. iriV:l n 1 . tv rtlf |™s* Irt 

V» -• Ifc^>i ftil-«| mjt j r'r-yirf: ^qiifl »*- ^i|i ., ler r r . h.s ..-1 ■!!* 1/wtW lit* tMl 

11 1 ■ lif .rm-t *.Li;if-| psrrn -r" 1 1" ?r»'H ^tlrt ^ It"' vv*Mil OripifcitsCM - *: 
!'« ■ ji/Jid fc" ■mini' Id' jf (vTfi-n r ..nvm mkI p^npnl V pri i*4^itl9 ('". * flle ^' 
$m ppriir Sw yaml fcri iiui nind inv iah (i'M*> nfrnv trche&ri ei^it^ kb^jv 

*"Lluil ■pfllP'*:r hi ,T ,' ~**i lUr 11H p^i iP/v^h Itip ?^a* hl*Y BMr feflVO 
I "ti Jir r:: . r/ 
IH viu«*-li'«i'fi >rtiil*.l|T3iJi*|i , f„i»pia*iip;ijTi!n-l.4l>iilhii5 1 *-mll»*mh 

.1,- -. li -v., ' 
UbiiWH ■ mi Cwfeal DmpiiMd S*-k rpjr», IKkkJ fi -I. h.^. IvMpa Bv* "Ib'iu i-nii 
(Wif*niWmmM. 

I? T*§^Lp^ijsiiPi»jr:^ciriui* J (idll , *hr J gWrtHfcr|.-wb7FH! HtVia •'■» J J«^ bi 
mcpnxfd Ln-udVas in i,acttjta jui ^' k r (;i h« ^p*dru:M1 ^ iriijjKii'Jiirlr**! 
rtllw li* ky ind bH LDfd*.i^ fl **■ I *l «.v^ Left* mp t'MAh #ip^ivn i-Vi I rjit; -in in 
■Jib:* Li ill enwr 0ah*n fi Hoi. -v \«i.r t tf ■cir^wpdHvpri J^ll pi p*t ww -^ai ft* 
■»iniiiorn.-| tlnrtn KH nmw PW Pip ft=,« Ul WbfJnUftfp pVH* 'Jifli ftp 
i-ir-a*- y utr tjiJ-. >V3«>- bv i!Ta»B<meiiic 

O rkrBMnk Bpf pBHtflrikT CcrattaMl IT ll» Ml»YT t> ** jMMxpp •i»pip«i!i * 
lHfc>»»i > iHl Jii >'iir»' PtJjlK aMMOimplTW ■lljlM> J ri -ik' iinnHJnupii 
M**t1*» UHi>d±EV.bi>ppAOniikr^i^a1» 




Quicksilva Mail Order, P.O. Box 6, Winn borne, Dorset BA21 7PY. 

Telephone (0202) 891744. 



WARNING ThHe programs Arc <ol4 jctorrtnp to QUICHSilAA Lid's termj of trad 3 and coidiliant of sjle_topi« of whi,h j'c aiiilabta en rtqucsL 

W1IGMTH © lllW.Wf'h'1 r i 



John Wemes 






News from the world of 
Sinclair QL computing. 



• 




QL Toolkit 




a - ■ ■■i-»'ti mi,. m 



Hf ^r ■** i ww vi Pa HifVP 



^ M "^*^<^ 1 ?^- 


S 




» 


LiaHtfatai 


ma ^ 






:\ 




One year old... 

and look how weVe grown ! 

When we launched the QL last year, we knew we were starting a 
revolution. 

For the first time, the serious computer hobhyist could afford the 
same power and performance as the professional computer user. 

A year laLer r and he QL is more than a unique compute'; ifs the 
heart of a unique system. 

And the next 12 months promise even more for QL owners ... 
new software options* extra storage devices, printers, monitors... 

Read on, and see how far we've come, and how mich further 
we're going! 



■bH-H 



KK 



JMWn 



m\ 






NIGEL 
EARLE 

low it's the 

quantum leap for 

QL software and 

peripherals 




V*ViS"i.'S« 



^SKS^SSS 5 ^' 



Without doubt the QL was the computer innovation of 1984. 
Launched to outstanding reviews, it soon gathered thousands 
of happy owners, and recognition from people like ICL r who 
have hcorporated QL lechnology and ts Microdrwes into 
the new One Per Desk. 



The quickest glance at I he Ql^s 

specification shows wiat the 
fuss was all about... 12EK RAM, 
32-bit processor architecture, 
200K Luilt -in md» iludgt, 
bundled software. They're fea- 
tures that would normally cost 
you thrse or four:imes«sniuch! 

But that's only half the story, 
because the QL is now the 
heai of a computer system 
with a growing library or sot- 
war,, , , , 

As you'll see fom tl^ese 
pages, 1985 is the year of the 
quantum leap for software and 
periDherals, Already there are 
no less than five Q_ lang- 
uages together with special pro- 
^rarn;> lor software developers, 
£ worid-bBaDng chess game... 
tnd mLCh more on the way! 

On the hand ware side, Unere's 
a special QL monitor to make 
ttip mrrcr nf rh-tf high -resokiticn 
512 x 25€ pixel dismay. There 



are memory expansion boards, 
Winchester dskdrives, printers, 
and lew-cost Microdrive cart- 
idges. 

Ii i lacL It ideV so Tiuch going 
^n, we'll be Tunning These 
-egular Ncw^etters just to keep 
yoi in touch! 

If you already own a CL 
the next few pages will give 
yoi a taste of ftc exciting year 
ahead. 

And if you don't . . . take a 
loufe d. w kit ytu're missing It 
should be all the persuasion 
/ouneed! 

Now read on, .the quaitun 
leap into serious computing 
starts here. 




Nigpl Searle, Managing Director, 
Sindai- Research Limited. 




From soph stickled busnra paikap^ Lo uiperbcinima(«i &*me> 

Ql wttw&C rtilkCSlhemolt ol !heCCrt-pirt?r'J t*trdortlriary ip«r(iir,itioi 



New QL Software 



Utilities, languages, games and business 
packages... with more on the way! 



Two things are now certain 
about Q. software, Fi'st, there's 
gang to be penty of r_ And 
se:ord, it's going to set com- 
pletely new standarcs for 
mcrccomputerc... 

At the moment, .here are 
well Over 100 scftware programs 

in dei/eiopment And the first 



software rfleasft^. shnvun rwe, 
demonstra:e how exceptional 
the best QL software wi I be. 

The QL already has five 
languages, superb programs for 
software developers, a top 
q j a I ty account i ng package and 
ir Q_ OtOs it ha: te first gam*. 



QLUB:10 r 000 members and growing! 



QLUB i< the special Users Bu'eau 
for Sinclair QL owners. There 
are no w well over 1 0JD00 QL U B 
menbdtt. and mpmrvrehip k 
growing all the time. 

For heir annual subscription 
of £35, QL J B members are en- 
joying 5 whole range of infor- 
mation and advsory services, 
exclusive offers and spedal 
discounts. 

One of the most important 
QLUB benefrs is the spfiffel 
news magazine, appearing si< 



timss a year, "he magazine pro- 
vides a forum fo- QL owners to 
sxciange view? and keep in 
rrw rh wit! al the l itsst cks«tep- 
meits. 

Eaci issue is packed with 
updates on QL hardware and 
software, tips on applying the 
fou' QL Pograms, and news of 
how o:her people are using the 
QL QLUB member also receive 
a range af specia discounts, 
with wvrng^. of at least 20% on 
selected software products. 



Current special offers in 
QL Chess for £1435 
QL Toolkit for £19.95 



QL Assembler for £31.95 
QL Cash Trader for £5495 
Spedal subscription rates 
for fersonal Computer News 
and QL User. 








I 



QL Toolkit 




L Cash Trader 




QLAssembler 



QLChess ** 



The multilingual 
Sinclair QL 

BCPL - a forerumerof C, 8CPL 
has been desc'ibed as a systems 
programmer's delight In the 
words of QL Usei, II i* loii- 
piler is a 'brilliant compromise 
between a high-level language 
and a low-level systems lar- 
ftjage".. Whilst not for beginners, 
this is an essential buy for any- 
one with a good knowledge of 
systems prcgramming Com plete 
with manual. 
Available from 
Metacamco-£5935. 
Tfcl:0272 438781 
LISP- already well -known fcr 
its artificial inteligence a^pl- 

Psion trouble- 
shooting service 

All QLUB members can obtain 
special assistance from ftinn 

on l. sing the QL Quill, Abacus, 
Archive and Easel programs 
supplied with the computer. 
Psion will normally answer an>< 
que« les with) n 48 hours 




catbns, LBP Is a powerfu ard 
versatile angiiage. This is a 
sophisticated implementation 
of LISP, by one of its leading 
exponent Dr Arthur Normal 
This packige features ful QL 
graphic, anc a tull manual is 
supplied. 
Available ft qui 
Metacomco -£59-95. 
Tel: 0272 42S781. 



OIBCHL 
OeVElOWfiVT 
WT— 

* tXVHjDPtOfT 

-- KIT 




1 



Pascal probably the -no;L 
popular hgh-levei language of 
all. Pascal is particjlarly well- 
suited to structured p-ogram- 
rnirgsopNsticated data rnanipu- 
liticn and algorithmic probtem 
Pascal interpret comoteie 
with S7-|LMge mai iual. 
Available ; rom 
Computer One- £39.95. 
'el: 0223 862616. 



11 




h«4 





Forth - this 'rew generation' 
language^ proving both popular 
and easy to cam. "he program 
provides a full rnple mentation 
of the latest Forth 83 standard 
wfii graphics and sound exten- 
sion. 

Available from 
Computer One -£2935. 
Te:0??3 862616 

APL - the compact natfiema- 
tics-based irterpreted larguage 
designed for scientists and 
mathematicians. 

APL ktyword inlcrpftter 
complete with manual. 
Available from 
MiCTOAPL -£99.95. 
Tel: 01-622 0395, 

Programmer's 



packs 



QL Assembler- two jtM-tdrtrs 
operating ir tandem. The first 
is i rul-screen editor for dealing 
and altering program fies. 
The second, a rVtotorda*format 
compatible 680O0 assembler 
which convers source fles 
wntten in MfesJUOO assembly 
language irto machine cede 
file? which can run on the QL. 
Both assembler and editor 
are written in machine code 
and can be multi taiked with 
SuperBASIC sc you can swr.ch 



bstween editcr, assembler and 
SuperBASIC instantly. 
Written by GST Computer 
Systems- £39.95.* 

QL Toolcit - a prcgrarnmers 
toolkit with over 70 program*. 
and exte nsions bo SuperBASIC 
Most an* linked to SuperBASIC 
initially and can .hei be used 
from commands or from wthin 
a program Enhancements in- 
clude printer spooling (print a 
file while running a SuperBASIC 
p'og'amj; m proved file access 
(with ful random inpubou:put 
command); job control (albwi 
management of multi-tascing 
p'og'ams including the ability 
to d splay, after priorities, and 
dslete lobs from the QL); and 
SuperBA5IC screen editor. 
V/r itten by Q J u mp - £2 4.95. * 

World-beating 
chess! 

QL Cheis- fresh f*om its victory 
at the World AAiaocompjte' 
Chess Championship, This pro- 
gram sets a conpletefy new 

standard for games software. 

There's a high resolutondis- 
pay animated 3-D graphics, 
and 2S kvtk of play from 
novice to champion Features 
include an ripenings hnnk oF 
nearly A0O3 moves, HINT and 
TAKEBACK functions that help 
you earn from your mistakes, 
and the option to pi ay a h u man 
opponent or the computer. 
Written by Psion -£19.95. + 

Software at work 

QL Touch 'n' Co - a unique 
approach to learning touch- 
typing skilfe. The p'ogram is 
designed to give you mar.ery 
of the standard QWERTY key- 
board in just 24 hours. With 
practice, you should soon reach 
40 wares per min jte, with over 
95% accuracy. 
Written by Harco jrf - £24.95. * 

QL Cash Trader - a unique 
Lurtipul^iiied buck- keeping 
system for small bjsin esses. The 
p'og'am provider a complete 
course in the principles of ac- 
countancy and goes on to 
become ar esiential aid in the 
day-lo-day ruining of a busi- 
ness. Compete with comsre- 
hensive manual. 
Wi itten by AtCQuilUuKy 
Software of Torquay- £6995.* 



■This title is available from 
Sinclair Research on 
0276 686100, and selected 
Sindar stockists nation w de. 



New QL Hardware 



An industry is born 



From the moment of its aunch, the revolutionary 01 r-ttracted 
massive interest from all quarters, 

In ene area, the interest quickly tuned to action, as high- 
tech hardware manufacturers realised the immense potential 
of the QL for vast expansion, for system development ard for 



widespread networtdng. Already the list of peripherals for 
the QL is very exciting- and lengthening by the day! 

Here, we've covered nany af ihe tate^, r»n4 important 
developments. 

As more appear be sure to keep in touch with OL News! 




The dedicated Sinclair 
Vision QL monitor 



Once vol see :he incredible 
graphics capabilbes of the QL 
you may decide tn ordinary TV 
just ;anT do them justice 
If thaK<, tlv* raw. 3 hjgtv 

fssdutbn monitor is needed, 
(And if you're creating presenta- 
t on -quality charts fcre<anp4e. 
it's quite essential.) 

The new Visicn QL monitor 
is SDedally designed for the 
cprrputer by Kaga Electron ks, 
witt" full support from Sinclair 
Research. 

So it exoioits the QL's rnax- 



mum 51 2 x 256 pixel resolution 
to the full with a pin-iha'p 85 
column d* play 

t's also specially styled losutt 
the QL - in looks, and in me. 
There's a 12* non -glare tube, 
and etched screen to ciffuse 
reflections. 

So the display is bn#ti. snap. 
much easer to loo< a: . . . and 
invaluable for those late-night 
prcgramning sessions 

And like the QL the Vision 
monitor fc n>&i{jied wth space 
in mind: i: has a compact foot- 



pnhtofjiJ5t12V/'by15 ff -no 
more thin a typical portable 
typewriter. 



ifs available from MBS Data 
Efficiency on 0442 60155 and 
selected Sinclair stockists. 




T"tOLvsuiert gra:ihiCsr«l|wMm<K-i1< CtemOn>lr.a!ttJ by IFe Sinclair VinonQl 
menita: 



Microdrive 

Now only £139! 



cartridges. I 



Micradiive cartridges are the 
QLs own uniqje storage media. 
Each stores ud to 130K of in- 
formation, on a carriage no 



bfggef Lhtn a matchbox! 

Over 500003 cartridge are 
now icing used throughout 
Britain. And QL Microd rives 



the rr selves are standard equip- 
ment on the new ICL Cne Per 
Desk micro, 

Now Ihe'e's mere good news 
for QL enthusiasts: from Feb- 
ruary 1, the cost of QL Micro- 
drive <4jELridgt:» are down frorr 
£4.95 to £199 each! 




%nt hit ftAionrlnv* rartrH+yt-iipto ITOKol [T03i*mj Jyvj d*l* oet a nw). im CO 



irto-ysui pockoL 



Powerful hard- 
disk system 

For the QL business user, the 
new Firefly QL Winchester disk 
will oqost the QL's pewer in 
one huge leap 

Dssigned by Quest, it use* 
CP/M and offers all the benefits 
o- Winchester technology: fas: 
access, d iabn I ity r compact si2e 
and quiet operation. 

Witt" 75 Mb storage, the 
Quest Firefly is ideal for large 
databases such as stock or cus- 



tomer lists Arid at under £1.200, 
t represents exceptional value 

br money. 

The Hrefty will be available 
very ihotly from Quest on 
34215 CG1QQ. 




M ncKeslttr hard d M dwe« jpp mtw nr 
ifCLir QlS bM-m fl1t« SlOr^C 



Interface options 

The QL comes corrplctc with 
two buit-in RS-232C interfaces. 
Ir add lion, ntenV**: for 
Centronics prnters are widely 
available iron manufacturers 
such as GST, Mirade Systems 
and Sigma Research . . . with 



trices torn only £35 

And that's jusi the beginning. 
: or attaching scientific and 
aboratory instrument; to the 
QL CST even ofer an IEEE-488 
nlerface, . wh ch can handle up 
jq '6 connected devices omul 
laneousry! 




Expansion boards 
for up to 4 times 
more memory! 

Aiio fron Quest, a si Tip e and 
inexpensive way to espand :he 
QW RAM- w/tfh mennry ex- 
pansion brcrd;. 

These compact jnte conrect 
to the standard CL expanson 
pert using the QL^ irlemaJ 
pewer souxe ou br larger 
beards, an external power jouree 

Ttx; unib range from C4K 
and 12SK RAM beards to mas- 
sively powerful ?5nK .^nd 517 K 
RAM bonrds, so tieres some- 
thing for every jse'. 




Pri:es start it £117, and the 
512K board is a very rost-effor- 
tive investment at just £537. 

WKh affoxfaole memcry Ike 
thii, the QL is more thar a 
match for any other mkro 
under £2.003! 



A Centrales inle'fau'slift diwectty into JatJ 



Where tO find the QL. The Sindar GL is available at selected branches of Dixons, 
W H Smith, John Lewis Partnership, Curry; Greens in Debenhamj and Ultimate, and larger 
branches of Boots, John Menzies and specialist computer stores nationwide. 



The spec 
behind the 
spectacle 



C 3 U - Central Processing Unit 
hast, powerful Motorola 68006 
chip. A second processor, ar 
Intel 8C49, controls the key- 
board, generates the sound, and 
art*; as an RS-232C receiver. 

RAM 

128K Now ^xpandabe to 640K 

ROM 
48K. 

C Derating system 

Cdos- revolutionary single-user 
nulti-tasking, windowing opera- 
ting system 

Storage 

Tvvii i bull-in QL MuotlnVe* Up 
to 103K storage each - transfer 
rate, jp :o 15K per secord. 

Keyboard 

Full moving 65-k-y QWERTY 
five function keys, four cu"sor 
keys. 

Language 

Sinclair structured SuperBASlC 

Applicatior software 

Ol Ouill-wnnH prnr-stfir 
GL Abatis - spreadsheet 
CL Easel -graphics 

GL Archive- database 

All four packages supplied 
wtththeQL. 

Interlaces 

Two serial RS-232C interfaces, 
Microdrive expansion psrt (isp 
to 6 rray be added), RAM 
cartridge port, local area net- 
work, 2 joystick ports, RGB 
mon tor and TV cutcuL 

Textscreer 

various modes - up to 85 cot- 
urn ns by 25 row; on moritot 
On TV up to 60 columns. 

Graphics resolution 

51 2 >: 256 pixels (four coou'}, 

256 x 256 pixels (eight coiojr). 



Sinclair Research Ltd 
Camberley Surrey, GU15 3ER. 
Te!: Gimberiey(0276) 636100. 



atfpt^d-conbRiuiipttdwftiivpMv&'nc it. Srw .ar iWaich LW-«rvete(^tlf *ll;#ip#:ift«tiofi;atjnylime 




■VA 



NCI'S: 



■«K 



m 





* * 



■ 

m 

■■ 
! . . . 


, - ** 


#*h, 








* 



s 



\ 







/ 



Yxi should see what he's just seen. 



Micronet SOO. 

Stretching the mind cf your micro 
far beyond its limits. 

NCicio evolution continues with 
this un :que communications, informs- 
tion and software system. Set on our 
mainframes nationwide, 

Includes 30,000 pages and access 
tc Prcster with its full rancp of services. 

A tremendous Communication:; 
section that ret works you to thousands 
ofothei members across the country 
Si'ntJ and receive Ejleetnmic messages 
and graphics at a Much of a button 

Asd there's the Chatline service, 
Swapshop and Teleshopping. 

Check with daily updates on the 
very latest computer news. 

Micronet also has its own huge 
(acts data hast;. 

A nd a choice of u p -to -the - m i nil tc 
software tu download absolutely free. 



Fjr anly £Y3 a n' nrt: * r an d just a 
local telephone call whenever you 
want to connect up (that's only 22p per 
hall hour at cheap rates^ you could be 
part of Micronet. 

The oc.ly accessory you need is a 
Modem. 

A small price to pay to join the 
other visbn&ries on ths exciting new 
system 



Fill n the coupon for more details 
and send to MicroneL 800, Durrani 
House 8 Herbal Hill. London EGlRSm, 

But be warned, Micitmsl 800s 
features arc almost limitless and 
constantly updating. So may he youd be 
hotter to call in at Laskysjonn Lewis, 
main Boots or your local Micronet 800 
Action Station 

To Jhist you: eyes or all the 
amazing things it can do. 

Pin: MlCRQNeTHMVDiwwnl Heme, 8 Hob*] lilTl 
I I.„ .1 i LClRSFj X,k|plii»c05 27S?n.t. 




DOUBTS FROM 
ACORNS GROW 

The first muns for Acorn's employees that 
Cambridge wasn't all growth and glittering prizes was 
A'litJi they jpeiiud ihe Daily Mai' r.c find an exclusive 
interview with their boss Chris Curry. There, anions: 
the revelations abort Curry 1 ;; steamy sex life, fist cars 
and million-pound mansion was rhe first mention of 
redundancies. 

Mcanwhilt, nest door but one to Acorn's customer 
Bctvice depart merit) the fa miliar sound of gently bjretine; 
bubbles could be heard as Oric sank beneath the waves 

Still within :he ci:y Jmits a surprisingly ruffled Sir 
Give Sinclair launched an unprovoked attack on Atari's 
QI .-bashing ST computers — claiming they were; ii 
:lgmeit of lack TramieTs imagination. Wishful thinking 
perhaps, giver the QL's disappointing sabs of 50,000 in 
a year which celebrated the production of ihc fve- 
milliomh Sinclair-designed micro. 

Could the curtains be closing on the stars of iht great 
liritish micro industry? So far 1935 has been a bad year 
ibr everybody, but don't expect to sse Sir Give trad.ng 
;n nit; l J ursche for a C 5 quite yet. 

Sinclair dominates the ILK. market as much today as 
ne did in 1981. But gone are the innovations. Even the 
1982 mode ol Cliv; Sinclair wouldn't have been 
content with rcboxiiig an existing machine. However 
good the Spectrum and despite his comm.trr.enr to the 
jSOOCj Sinclair now runs the risk of becoming a cne- 
comp iter company. Yet whereas that could be a 
problem in the making, Accrn has an immediate and 
deep crisis on ils> hands. 

Irs shares had fallen from a high of 193p last year to 
23p before they were tcmpcraiily suspended un the 
Stcck Exchange at 28p, Job cuts and a major 
reorganisation nvz parr of prying the price fcr £ poor 
Chris: mas and the disastrous foray into the U.S. marke - . 
The abortive American project may have tost the 
company as much as jfl2mi.lion and its recent £20,000 
sales lo "Russia won't make- much of a dent in that. 
Apart from that, the BBC Micro isn't getting any 
younger or appreciably cheaper, and Arom may Irani 
:hat producing business machines isn't really as ctsy as 
ABC. 

But despite the pall of gloom, spending or. home 
computers should rise sharply this year — up to a 
record 0%million according to stockbroker* Wood 
Mackenzie, All Lie British companies Juws to do is go 
.nut and grgfe their share. 



v.i ;■ r v ,| ■ i,.„ .,,, i-,ii,,,- Ml HON -.'■■i-'- t' — «,—-i-, i Vdii-r I vl 

VAl.tEl.r,9«r(»aiTfctilurv5ilVl>NH|i.J-:it.tVSu-.li[IiMr:l , .'i' I HUSH InlltOrLnl AtiLManC: 
LEE TMinONi UllOnl Sctrcctre l.VKN' DAWSON ¥.dti*-.4. ^1 Ml 11 M. .^Wrti-tnw n 

Huifcr V?i K .HA !Ml re. ■'!'■' ! !.., Sm«r S,ilr- Hf -t I I I '. N HIHJlKE fl 6*1 

H58; M*% nii*m«i( Exteiaivn: NIGEL BORRE_l. Kftftl Mltti; KM' -II WX C14* lUftt: 
i Omit: CiEOFI r\KKEK t* I 832 Obi. «nJnr<i*mirrt Sr'rr!*yt HA XI SK Oil 
SI SAN I'l.VITS QH41 KOfj Pkbli^uiK tttnttun t HMS KIMPEJU Ur*i r 
Vdvcnnimtri Mioafcn JHOtHAH fiAJJA-1. Ymr Ownp-.nrr. Hmti L22], ^uHfcxnt Hsii'C, 

J"hr > }ti nh il-il , SeiEI -ttk. Sail ir< *iM) SAi hmmni t*.*,, lihrirt*iSI*nPrjtfl I (J IW5. Fripis4 in C.w.vt 

JfiU n I'M :fct f«p--tt«n UlLiatH; P<*i» lliftrliiahuBiJ i.rd Qmslnti ll<ntf . ',t)e QtMdMAI. Sjifni, 
«im Sill MS <[ <\m B*>, Tttexgiufe. HYjimi ft I IK hs* i IS*N 4».l«06f Pi^cJ w 
ftncoMc Pro> 1 Ml WMmtk, Kht, lad ztpntt L-v lump l.ij. l.iin!*F EC . SsHCfijiueai; U.S. 
£12 '*> fiw I*' BMW. SuhKrfMICRt iiouiitt; 11'IHt |-»lr» AH: I'l.Ml Ivuio 1 lOBt JWH. 




Creassy contfolling Dqu^b^ Herd's muscle moTemenl. 

PLEA FOR 
DISABLED 



Dr. Gkahaai CRE/iSEVS plea for 
Kincriincul lumjiiig it- M pv« ihc 
disabled js much apceti to micros 
iitt pt-opl: in s:hools" if brine 
itini 1 *] t-il i by the Depcrltn«nt of 
Healn ;md Stitial Security. 

'A micro tan be at Icasi as jsc- 
Ju. as a *hcdchaii ' , says (*itiw:y 
who usts BBC Micros in his 
spina! anil m Edinburfh'j 
bUenh^Sl Hcspi:a1 tu improve his 
p&iurls 1 tnmiuil dL'XlcfiLy wKiSt 
triicitiiiuie [hem. 

He is :ilso usin;^ nicros for 



ysi? Iv uonlrdlliii^ a sencs of 
iktuiul fhot'kh lo thTMilait ihe 
muscles. 

The Dt-Mraiim of Trace and 
InJuiil v uliL-i.ly ntuki^ L."!miUion 
a year jviiilal-k :'nu:i its inibmi- 
aticn technology budge: for 
sch^mfs inclucini fuiuiiunal 
clftlHiiit stinirlirion and lemntc 
wcifli unitt for the tli Babied. 

Dul lie IJH.Vs sir's il h.s "nu 
pins" to cxici.J this sort of 
Bcheroc to make mkros aytilable 
to all ihe disabled who mieht 
buncfit- 



Oric slides 



Oric has crashed, dong with 

Prisun u.'Wh JiPtril-iilvd (he 

Atnws a? w;ll a^ the Spccliuili 

anJ the Eiiidpriae. 

Sinclair and boterpnse have 
made ursrnactTe urnn^-nicnrs 

s]n] &f rfrei-.-ers ara now WiVitig 
ibr buyers Liu Oric LinJ Prism. 
Barrj' Mnncasier of Oric is fug- 
j.l. r.Liu ;i manigemem buy-out 
ani a mult [national company is 

aim h-lii"v*f I In hi- iniiTf'<; - cd, 

Otic's normally talkative 



Marketing ConsuLrart Bruce 
l-.i'crkt. whyo Iwil jfcar juniptd 

bdbrc Imsfiii.e Jell, .villtiti.v sjvt 
"If I had icxjfsislhjll I Wouldn't 
be Sim ng here now Bui he 
admits thit French Almos sales 

hair-e collapsed in i\k list a>upk 
iif months — "tbe Amsirad is 'he 
cult machine in France- jt 'he 
mo;Tieiu". 

In RriUin Oric hus Hunu'ii 
Prtfm for fiiiir.g :o didribjH 
property. 



20 YOUR COMPUTED, MA^lCH 19B5 



PRICE FIGHTS 

Sinclair and Acorn war 




Commsdore 12 ft: Csn CBM djch the price war? 



Missive j-fttCK cuts, £50 >»!T Ik 
S|xcir jm Plu* and £70 ciT he 
F.la-iron, have kii the two old 
rivals squaring up to each u:hei ;n 
the jCliO mar*. The firM casualty 
of ihc war has bcai die "dead 
flesh 1 " keyboard af the old 
Spectrum which has hetin buried 
wilhmi lereTiony — only 'he 
click keyboard Plus will continue. 



A i'lus upgrade liom ShcLir 
for ail old Sped rum vill coJt £30 
— or £20 for a kk which may* put 
othei keyboard makers om of 
business Sinclair, whs ctlctrated 
dit manufacture or the five 
millonth Siiicair designed micro 
last month, has also takers on 
Com moduli: by chopping the 
price of Microdrive, cartridges to 



ti ard claiming ikn I he Mxro- 
drive saves and loads faster :hao 
rl»- mtOrfat sly slow CUM :54. 
disc drive. 

Bo I Commodore insist* St will 
not oil prices yet Nevertheless 
expect a cheaper 64 to .nale rram 
tVir rhi L HHV\ ,2B litis rammer, 
"["his miy leave ihc C-16 and 
Ptus-4 in nc-m;n'i land. 



TOUCHING BYEBYE 
TO THE KEYBOARD 




TmiChtMrh tUrrtS SCr«ft into fJifXSf. 

TOUCHSCREENS are the ulrimue 
in meejipriced accessories fur the 
executive who lias every th ng — 

except i hi: ah i]ity to communicate 



with a micro through its key- 
board . 

Now M,icro\itet is introducirg 
the first buLgci prLcd touch- 



screen, the I ouchiech SO I, which 
will allow [he ilea ro be used to 
teach youngsters and tX dis- 
.it-h-d I'v SO] is i J: imt which 
fits over :hc screen of sn nrilinary 
Kin. Micro/itc: it unit ur. 

The frame contains a grid o:~ 
jzjclfc ml'ra red bean's anc 
sensors vlikh are hirmipted if s 
finger is placed on :h«! screen. To 
imprcve resolution, each bsiir. 
fans jut acros* llircc rcsxptorv 
whicf. cin din inguish it t'orr. 
ntner beams — this gives tip tc 
m llimftrf rpsnlntion IK the eecitrt 
of the scieer. 

rouchiecK coma w.th a pack- 
age cf programs ranging Ion 
ncughts and crosses to an arlisi 
prngnr*! whirl' »lowt yarn it 
pant on screen wilh your finget 
using a palette of $x colours. 



Open the 
box for 
C4's telly 
software 

Tcllv soFrwAAti illowG you to 
dowotoac pi >>grains Klraigbi fmm 
voir television- All vrni need is a 
home made l.ghi pen to slick ever 
the pulsating Cursor square which 
will h-z uppoarin^ in rhc corner of 
the screen Oh Channel 4's new 
show, 1 Computer Bulls, every 
Mzmday night. 

.vliln: Tlmrne of University 
Cc'llejiCj Cardiff has produced a 
design for a pen which you could 
mike yourself for less than £5. All 
yoa heed w do is plug it in o your 
computer — Spictrum ani BBC 
prigrlm* vill fce broadcast 
initial y - and a'tac^i the lijhl cell 
end lo the screen wlierc it can 

pick tip the biniry code flashiug 
through. 

BucauHt the E-pu^d or'dala trans 
miss it n ii limitci bv die stan -aic 
of the l clevis on screen it can lake 
five nrinutcs to toad each kilobyte 
of prcBranii. 

Quickdisc 
takes on 

Microti rives 

QUCK nsv> tor tie Spectrum 
should be available from April foi 
around £.103. The Ctescent 
CjLiickies jst a spiral disc like a 
record which cannot be raivlor.ily 
accessed Ike the concentric discs 
wh.ch make moat diw drivf"! «n 
fusi. However according to the 
Crescent's maJters, Serviam 
Dy^mlcs, it is up m 20 times 
faster than a Microdrive. 

Commodore 
on Telsoft 

NtXTMOMT.-i our Telsoh service 
kicks off ihe new Commocore 64 
facility with Lie Space Junk 

pmgr;m wfidi starts ii this 

So far I2,OOU calls hav. ; txen 
made to the free iownU-ading iei- 
vic? si.TceTesoft opened up with 
BBC and Spectrum programs 
from car D*cemb«r issue. Detiils; 
of transmission times for your 
iiiajhine on ('3206) S068, 



Y C UR CO M P UTEfl, M AR^ H 1 986 21 






AN* 

MMee 








-Miles Better Software—! 


221 Cannock Road, 


Cfcodsnioor, Cannot k 


Staffs WS1 1 2DD. 


Id: (054SS' 3577 


U.S. Gold Software 




zx 


cm 


OtATAfd 




CMS 


CASS 


DISC 


Beach Head* 


6,95 


1,95 


it.fS 


Raid on Mohow 


6.95 


3.95 


11.95 


Strip Poker 


6.95 


395 


11.95 


Forbiddor Fores) * 




*95 


11.00 


Aztec Challenge* 




7 95 


11. 00 


Slinky' 




F.9S 


11. 00 


CowAi Hholka* 




7.95 


11. DO 


Poayon 




J.9i 


II, ws 


Brute Lea* 


6.95 


8.95 


12,95 


Dnl Fat. Quest* 






12,95 


Sh niktw" 




f.95 


it.ts 


fkk' 




3.95 


12.95 


Slr-llnr 7 




3.9S 


11.95 


Mystic Mention 




7 ?; 


ii no 


Solo Fight* 


8.95 


14,95 


12.95 


Sptf ir* A;e' 




3.95 


11.95 


FK-Eogl** 


8.P5 


12.99 


12. «S 


NATO Commander* 




3.95 


11.95 


Indiana Jonet 




3.95 




Tnpfiwr 


A M 


S.95 


11, fl* 


Congo Bongo 


6.95 


3.95 


11.95 


Up ii Down 


6.95 


3.95 


11.95 


Spy Huntar 


AM 


3.95 


11 95 


8gik Rogers 


6,95 


§.95 


11.95 


Kntghls Ctasort' 




12.95 


12.95 


Combo Ii Leader" 




12.95 


12.95 


Bui He No-nxmdi* 




12.95 


12.95 


F<k1 Apocotypse" 


4,95 


3,95 


12.95 


Dralbs' 


6.95 


3.95 


12.95 


Blvo Wok' 


6.95 


195 


12.95 


Sefttfnol 




4.95 


13.95 


Zaxxon' 


6.95 


3.95 


12.95 


'Avciiobh to the- Alan 






PI*Obt pkO*»» lp* M>l(»ofc nvaiabilh/ ord uJlvrO* 


111 It f» itn 6* Hid Afvl ' 


ADO tl tar Qif*-UW o tier: 






*«.&* VISA 



THE VIKINGS 
ARE COMING!!! 

SWESCOT are proud to announce that we 
will soon be releasing severel top Quality 
programmes on the international marke:, 
made by some of Sweden's most 
proficient prograrnrrGrs. 
And best of all....... ..PRICES FROM £1.99 

Du son be i Skandinavien och sdkei bra 
program till din hendator. 

KONTAKTA OS!!! 

Vi har del mesta som finns i derma tidning 

till sammalaga priser soni gaiter i England. 

Dessutom far vi in alia ryheter samtidigt 

som de slapps i England. 

03SIM Vid katalogbeslallning v.g. medsanc 5; - Sk' 
i frinorken for portot. 

SWESCOT 

8ox 213 

121 02 Johanneshov 

Sweden 

08/39 27 CO - 08/81 18 01 



22 fOUR CQMPLTER, MARCH 19B*> 



"The OUT lUiciicu.-iI (u break 
my kt ccs las: wick" jokes Brace 
Evihte.wcU we hope i: was 3 
joke, tfttl (iilkii^ t« Fireinirr't 
nW backer, MTtp dealing 
itaUtinuun: Talbjf Smith. 
Fitciron - horn; of Imagine 
refugeex like Eugene Hvans and 
Dave Luwson — has been 
pl^utd with practical tikis. 
One week sb; driving schools, 
tumcc up to give nip-rime 
Lotus dnvcr, new Beetle owner, 
Eugene fan first driving lesson. 
Fof seme reusar frying pan io 
fue ^j-ctidibi tinice — who 
mevee from Iniigini: id Qric — 
fell uttder suspicion and was 
warned oil by someon? he 
describes as "Tdbot Smith's 
&vy\K ". Mild-mannered Bruce 
replied by sending him a bunch 
nf ilatTodils which rrovokiJ tie 
call from the breaker's yar J. 

Eye f\ I < it firmly in place and 
parrot on shoulder I ring ip z 
Mr Kaniader or Py: Clrcaitt 
TjtMtt nciif Ihrndty wlio » 
ofT:rii.g Cummidore 64 
software for >ak L V1 copied hit 
excellent* 1 from iape ? disc ar 
cartriege. His. "brother" 

jA3Wcr.it Mr Kamadcn is iumI 
theren 1 identify myidf and s?y 1 
will be btck in much, "Jim you 
be careful", the "brother" 
rephc:, "or 111 be back in toLch 

with >OU gO<d and pmptr". 

AMSmAf: HCSs \lan Sugar Iks 
been sirring rumour? *>f new 
Amstrads — esstmiiily diirercnt 
versions cf the current machine 
wilh built-in drives anc more 
memory — but Amstrad is 
kcipini; niuiLL alum the JiLiiilv 
Artisoft's Gillian Pud — the 
m:in who offered TO tat an 
Amstrad in Tralalgjr fequtrc T 
the machine * r as tot: — says 
Ru£.ir\ iptithng principle b 
"don't stimuate until you can 
coniumimte ^. 

I know sale* of the QL could 
be beuer but dues Sinclair have 
in go o the extreme of giving 
away hundreds of them to 
Sliallclyilt: Uuctnaiy in order 
in win i hi tuluv:nn tiibute that 
very few have gone wrung? 



ACQRKSOFT'S David Jchnsun 
navk't will he surprised to hear 
himself described as "a cross 
between Ivan Ltndl and an 
Egyptian mimrry", pa'ticulariy 
by torwott who is abeut <a 
ljinnrh hi*, h'lite on :he f_'HM-54. 
Allegedly David "is goni at 
tcnttf, gcrs a-; far as the &eml- 
fmals and then trips over the 
bandages". What can this mean? 



ANGRY ATARI 

Jack's boys hit back 



At/>ri is accusikg Siickir of 
>Liur grapes after his artacts on 
the new ST aucros. "Sir Clive 
tried with the C>- and it basn'i 
succeeded'", lays Atari's: ILK. 
m:ulf i-linc. iliTrCHlr Robert 

Harding. 

Sinclair idnits lha: "'W was a 
lOufili year lor tin. (JL" but 
iiLsisi s lhat '"85 is go ng 10 be the 
year of die QL" rather than of the 
rival 680Gf>based Auri ST ran^c 
which Mr Clht cfiiius w.ll K- luu- 
nid disupjuiin trig 

Hard ng's schedule for this 
jtixt k ni intfodue? [In? Infinity 
package on the 800 XL for 
trociid £bX) this spring — this 
Hvhkk-i w-jra processor, sp:llittg 
L-hetkLT, database a\& spread- 
shepfj htirvh rhj» If-hir STf in 
the sunmicr ;nd tht 8-bit £P0 
12SK XE replacement for The XL 
m tht: autumn. 

The 12SK 130ST wiH oosi m 

mnn- tri^n a OT and The 520 ST 




Tramlel's new Atari ET t and hehind, XE micos- 

with half megabyte Ra.ii, TV 
monitor, 15in. drive, mtuse, 
printer anc Inilfity less ilian 
Xi,0CO. WhtiK-; niacin se ^-iTJ 



answer the hRrX'O-hHsed q. test ion 
— jack Tratrid'i or Sir Cl.ve's — 
or will :hej sctde it over 15 
rounds tr. iht Bjiou ufHuif. 



ROCKY HORROR 
A SMALL SCREAM 




Rocky Honor: Can Brae and Janet 
Bamsko in .South Air km rwi i 'ic 
t round* that repeated Rowings 
would corrcpt the na' tor's 
youth, and even rno*e 
mysteriously detetec fr^m Cliff 
RiclurJ's (iiimnry the Kar^y 
Horror Show is a^out to m 
untiased cnio Th; smali screetis 
ot a million Spectru.us. 

Richard O'Brien's camp, 
tot hie, glair-rock, fantasy hormr 
j poof musical which spun off I ^e 
$tagc ia!o films, returds, books . 



survive? 

find T^r-ii-s in rhp mid 19?0'v 

will te a CPL computer pme by 

March. 

But writer R-.clurd wil net Ot 
playing much part in the project 
store h* is "ii'riifieH cf t*cb- 
nolopy" — he does not u-«e a 
wurd proL-L-uior, nor even a type- 
writer. "'I'd rather wjrk wtrh i 

pad. zfid a pencil." He'i leading 
tVp prft^Wiirnmng tn longtime 
Horror fen Ian El! cry, 
You can be Brad or J&iitt, 



clean cut American tetnagers ;ts 
you "nam rhr Kattnferl ind 
decidodly decadent house try.ng 
to i'ree your coinpaniim who has 
hetn turned :o ston;, encounter- 
ing Such wrckv characters as 
H.dHv — the ibroe from h*i 
frc^-er. While the Spectrum 
does not five fu I range to songs 
1 i kc Seie Hi t Fun on ■ i)eut>tt 
Feature CRL is alrtady wnrk ng 
n*i a Crimmixk»r-e 64 ters.tm 
with the declared aim of better- 
ing Activist 3 n''» tendering of 
Cihus trusters — hut lien CRL 
also clain-.s thai Rocky Horror IS 
"(food wboleionie iimily fun/ 1 

Cliff Richard? ~ O'Brien was 
waxhing TV the other day when 
he heard Cliff talking ldoui Roy 
Genrgi:, "Nu-tnc would have 
thought ten years ago that a man 
dressed up at a girl would b* a 
hit". "Wronp, ClifT" was 
O'Brkn's reaction — in 1*75 
Rorky Honor'* show s:opper 
Tiin Curry in his h ph heek end 
fishne' stock.ngi was the talk of 
the town. 



YOURCCMPUTER. WAFCH 19A5 23 




TOP 
SHOWROOM 




ROCK 

BOTTOM 

PRICES 



'* -* ■* Even further price reductions 
this month are indicated with an arrow -* — — 

Tha UK's Bogt Printer Pricas 

Only a Simple of our massive range Of printers 
snouvn here - phone for further details 

DfllSVWHEELLETTEP QUALITY 

Juk61D0[PJ £3*9.91] ■•- VAT - 

Bi-jL'iurHRibll'BndS) L329 W + VAT- 

LUwystty yiXlUlf 1 ! .... LS:9.95 + VAT= 

PRINTEH/TYPEWFIITERS 

Brother CF32 Oht VfltnilSl , £109 CO -VAT - 

fln-fJinr Fpifl ffil £^69 00 -" MT- 

Modems ov4! lab (i fnr Fa&vlsirt ar<) Te'piam Gdd 

rj?i5O0-t-vAT- casus 



C4D2 39 
£37835 
£275 94 



El £5 35 
ES17.3S 



Juk 220Q DuayAhml [Pflr F: 
DOTWftTRIXPflKVTER5 

nrerterM1009CP»mja. ,• ... . GIE.9.K1 ■ vftT 

Rit-EherHRS'PorSl Hi £5.65 +■ VAT= 

CannninBOANLQFJ .. . C3W •:■.::- vA I - 

R^nfjn 1 1 S6A l\iLQ (P) C3E6.&3 - VAT- 

CPfiONHxapini ti:B.OQ i yat- 

FpsoNRxacFTPLusiP) caaooo + wiT.- 

EPSON FXFjOrPf. . C3E4.CQ + VAT= 
F-PSONRXiClOFTfPJ £339 96* W- 

FPRnMpyiVIFTrP] C4S0D0-vat-- 

KflfJ)U«an<PaiaM_QiP) Ca39 00 + VA7- 

KMaTfl<an<P9lQMOlP3. £379O0-vAr 

SmhRh^GPSOOACP] '. C113.0Q-VAT- 

Snilnsha GP7nilA Cnlnir fPl Wfl £14- VAT- 

Sfiinwfl^TAnnPl, £199 90 + VAT- 

(PI -Rarsi lei-Centronics [SJ^SshhI ^SPSP 

Sffirth Corona r-anfo alprintoi-s lUawra Stock — 

P ho nil rar Ukl-itrt Irtr H ACjllo 



C 191.33 
E143 75 
C35E3S 
E45G44 
CCEL4 es 
tSb3.O0 
'.T/E6D 
E 3 90 9b 
C4B4.SD 
£332 3S 
E435S5 
E1S9 95 
r?7B95 
CZZ9S9 



INSTANT CREDIT Up to 36 months to pay 

j All items oyer £150 available 01 jr easy credit :erms. 
1 Written deta Is available an request. 



SUPERDISKS 

LONDON'S LOWEST PRICES ON FLOPPY DISKS 



12" MONITORS - GREEN SCREEN 

Smvi 21 1P Vl*f1 Sum 

Sanyo Oil? HiQhRcii 

td" MONITORS - C9LOUH 

CDTir-<x!cre' 7D' Cnrnposie'SriLfld . . 

MiHIKy i^Mli P[i J.' Cti-np.-'Spwrt 

Mi i/vfluu " 13' GS Mum 'VjifFjE, 

V>yovt«H: 1431 DZ 'm ZK SpECtrum. 

MerawteR 1 4S1DS Me3 Ftei W-H 

•VIcTrvrtra; 1 ±51 DO <w Kiraljfr C1J. 

Mctcvibjc 1 J.I 1 CS High Res HOB . . 

Sniiyu .3 125 'Jnn*. HeKHQC 

!i.i »■:: 111 -Vr:^', F!:ll 

Sanyo JII^HiphReE. RGB . . 

CornntdDn 

*£lix 1 NTW 15 'K Cu— fiii^i- 

L'OStErt^rjachnc GassntKdKt . . . 

iiDinnotxij 31 

S«HiRi-LnlF.-.ni:n lTTm.-™jr:. T ' MrriLrr 

: ;;tji",i •■,!■! ■■ 
iSii D<tC-»a . 

i'' -'II 'Lfirpr^l*- 

BOH "r-ictJCn Tracer ?nmer . . , 

1731 CotM-MenfcO" 

^PC-iS* f^rtf i tenner ii? FflSE sohwar-t 
;PC'-C^ CsKui* HenihT mc x s|; sfiwan! 

SANYO UK 9S9 Bulimic Csmpitor 
1F'3l r ■ i.j.Jiinj '/.hn iImj. BMMa.MMd 

fla>rn/gBC 

Aesrr E f eiwi .... 

BBC Utdel E ... 

Willi- nmrRmtlF 
Jul-iJlftl 1lIffl<OD 

.11 Ihl'l 



■■ id 1 *!QG^ C 
i,,xi:n. i 



x-m'i 
: :.i 



— CuTuwwSilOtKQnirePSJ 

- =u-n»niS<SJQK3D ief*£j 



ftllalnve C-jnarr* Pis* Ori-nC* mUuse ;*hf . W (i>g*l 
MittMi 

111 li".H. 

MP.".' Smclnim A}* Plyf 

Microd-^E ■" InceHace + 1 T*ee Prfgrams. 

i6<-4a;unj™''' 

bBXOMHUHJtkl*:.. 

JV-HCTCaGIK 

Ful '5«e ol MSX fleece f<m amfafak 



i'.fiSlYH Wft.T = 
CUE- SD * Wj = 



i.l|>?03 4 -VA"T= 

L18?0G-W1 

r ,j, rir; ■ *l- 

;SJ^74-VAT- 
:37CQC-VAT= 

r i ? r dd ■ ■.*»_ 

, "I ! ",■ I U4 

■J7.i ;?r;-'.«- 
^[■6 ittfi!= 
;ib: q" 1 - *t- 

f-£GCi&3*WHT 



.;-,..,, 



YAI 



ETKO'Vn- 



T ICr BO ■ VA1 = 
;l:-.i ■.*' 



H 5 7C-WT= 
C2EflCMt-UM 



C101.EC 



E194,3£ 
C1M.91 

cza.aa 

EEB3.3E 
C439.8E 

tiaa a; 

t3E7,7S 

MM. Sir 

cam be 

El 14 .9! 

ClSB.Bt 

C 509 95 

C37.9C 

»H Bi 

C149 9£ 
EBB».Bi 
CT99 0C 

£308 It 



£ 114, BE 

fIBl TS 
C£B2.D! 
C333.3S 

, -i'N, n-- 



£384 SE 

"S3 Q. 

EE4.» 



EBB1.7! 





Prices per bn* of lei ex W 






SSOD 
40TB 


DSCU 


ESSfTPI 

ao _ R 


Q896IP1 
BDTR 


BASF S 1 ^' 


£10.95 


£1fl.E0 


£19.00 


£22.50 


3U 5V 


£13.65 


£19.50 


£2105 


£24.00 


WERBSTIMS 1 *' 


£14.50 


£19.50 


£13.50 


£25.50 


DTSANQ^ 


£16. BO 


EZfl.30 


£2490 


£32.00 


TDKE 1 /' 


£17.50 


£25.50 


— 


£33.00 



Apricot Computers 

Fantastic Low Prices - All models in stock: 
F1 • Apricot PC • Xi * Portable t 
PHONE NOW! 



Mail Order + Export + Trade 
Hot Line Phone 01-BBB S362 

Delivery fty Seoi nrfi* l. r ir!a>1plfsvscaflf1L'h 111 VAI per item 
Deiiveryay 1 I N.I. I.D^mghtJpteasR idil i2.-£ * VAi i:pr tenr. 

Sc"t pffthc 30ir|X]T U"r3rdt;rljy 'dhtjnc qjutmrj vai«" AlXjJGG. 
flqiTlflyrRi'rJNr:- .PiorwiMI FJ{JHH:iBP :irn-iiirXP 
cespatch an recapt if afrieror cheque riffurancs. 

Ur you can TelfiKyouronderon. 94K]4D Attn 19D013E5 



'fie. fti-.tP.m nil ii-nl .-jn^rs linm PI IT« rin-.^-rr - ^rt FlBrarta l * «n 
Bid EiticoUsnai usiaHis^—er.iE 

TheSKI"' ,|. . i-i i | . ■iiji-n , . li'll Ir, -^'ii ,njv^ ^ ^-t^-c^' 



3M/BASF 3 1 .?- £H?fl 



Ailil7li|i-"FFSP[](jrbnx[]M0dskE 

CASH S CARRY COMPUTERS 

53-59 High Street 
Croydon, Sumy CR0 1GD. 



■"l''.i'.".ii||if 



rn&lwc "n 1 ^tq^c <c- C. 



_*Wl»Srtq i*th*'V !H SfflTUTlCtr/T >i I ■ 



■:r cl"arqfi mv At^Fsii'SafTJavtaril Kin 



I. 



•Plirsn.pliiiii'.i 



'.'M»'h'-T,l,lV 



tiid ■ 



24 YOUfl COMPUTER, MARCH 1EBS 



POP* 
TOPS 

SOFTWARE 
TOP 20 

t I Gbostbuslaia AtlrrtstiM Bp 
Dtcattton 

1 4 Bwly FlfOfcinJ Sp 



h RM (Mm Uto Or.un 



$ S«1«-t 



Rvnm; 



- 7 An *liK i in<- Sp 
I B Kinqhi LOfH Ultnwtfl Sp 

t 9 Coition Unt Ma teen Bp 

I 10 iJn<tef*wrti)fl UK mate Sp 

t U Eltt Acorn Be 

- i? Shade P«k Tyiwicri « 

- 13 3«f«y« Paid Aiyji El 

» U Fill G jv Eh'e So 

♦ 15 VXId &uftC4 HntrtiJ So 

■ IG HJHtriwcn It Ocjim Bp 

' 17 QjWPttriws Sioefk" El 

J 18 Siodcoie Mitfiosjtw- 





n 


Sp 


I '0 Sieve Oavif 


COS 


Sp 


Sn pok?r 






. Jll 9 irn_:t> Mouse 


Cftfiilvg 


Sp 


Irt Ool L lu 


^fjjrks 




Tinithie 






Sn =, SfXiCGurrvBc 


^ BBCJ1J = 


cte 


El s EluelroroVr i« 


Vic 20 




Ur = uayOi-,'6* =- CBM0<1 




Am - jHm?HT&(tjQr - 


- QrfcM - 


*i^n 


" - HQJJ ruUJSIS^ — 


— EajT,^ po 


EJtfgr 


Sot ■«« Wh SMITH 







SOFTWARE 
TOP 3 BY 

MACHINE 



QMIM C*n|ianv Machine 

— I STW*8f Vl9teci3 Vc 
? t/ftx A'wo'j Vn 

1 ;< Out* Shoal M "roue Vc 

— i MsigSifit«6 Oc*an (14 

Baqt 

/ nuivcaDaCK ll IJcciin hJ 

3 Ghosltius irrSi Acl risisi St 

— 1 Malcfi Day tjce,in $p 
t > f=fl I I inm 1 (in Oxtail Sp 

GinJfl 

1 3 hunchharh ll Gctao sp 

' i Chucilu Eflg AIT Dr 

1 2 hUlcltljKk Oc*stn :.)! 

-- i CulWtPllW MlusuiK.il! D« 

I 7^7 eimulotor [Joelorcoll De 

— I Mi EE MiiK'icuvttr DC 
* KjfStLQKj QinlUfV Be 

t 1 Eneovnlei Hi-l^chi Ajt 

" I £>*xcn Certf«H5<t Af 

j 3 Solo Hlprt t>r-[ifi*1i A; 

t i Cr«yGoit ^onmniCMe 18 

EKitr 

f 3 RlghlQlE CrfloCgmni 16 

t I Larft yp.Hir WiilU'.n jut Pi 

Lonnit hnusr: 

— 2 Cliuclls Esfl A6.F El 
I 1 Snoota VI son* El 

1 I hralMJ Mtlellmi- Am 

fcfanaifa 

— 2 StST Tur'iriirv! At 

CtHTinanrtto 

-- 3 GaiOtib fcUctipow Aft 
&nr« - V7etm«fsSaii*m 



MTX IS OK! 

Whrx will, (anics wrkirs a^d racm 
bnycrt rraLiw Tie -witi-ntjal af lbs 
^.ciTUtixh »crifi? Consiltr l he 
iV.emiteci M'l'X 503, boltora of" the 

i jn^c ,\ i a pr iv.t uf £ i w i 1 1 ? m y X 
quality, tho»c ri ** nw cnnpatiTilc with 
the iMSX mkioi 

11 you consdci it is only t_2U raaie 
ihan ihc Spcctnun +, ai il79, whkii 
wuuU tou buii'? The MTX 50O kaa as 
much a& the Spcctrun *■ and norr, 

I HighD" Roloui rnsolij'inn 

■ 6i.iU In assembltr'disassembfer. 

■ Sf rite graphics 

I A far jurarior kevboifd, 

■ iijcobiifSCCmpaieC to i*ie 
Sr;eclium +'f eight, 

■ BliII in texl brmettl-vfl.— 
Noddy. 

■ Fastei oP'Jialing speed 

■ Luudtf and b*lle' sound, pliyed 
LhftajEli the TV's loudspeaker 

■ Logo lypa graphic ccmrraincs. 

■ T*o joystick ports- 

■ ceniromcs'HGtwnii-1 etc. pens. 

■ Separate 4am reserved for 
graphics. 

So come 01 all ymi game wirers 
and micro buyeri — Th riV. 

Sfltf/iUTM, 

DATACALC BUGS 

T.HAMC SOL* tor pubbhing ay aiirfe 
l)it,Kdi;. 'There are trtf gr Jirce 
er-0fs iwinicJ uut » nc slnct the 
puhlkalion, and persapf yvj would 
be Kind enlugn l« imbith the 
In Iowitik; .imtiultitrTHs 

■ If DF5 <$ lilted then line 100 
ahoutc rftad: "00 Yl ^ 45: etc. 

I TousE trigorrelrual iunctions in 
the formulae "he mo 17£5 
shouic ne atidflti 
l725IFMlDi(BlK,3t ■ '-5IN" 
OR MO £(B5. ie, 31 = "COS 
THENC* - CI + SVIDS(Bi, X. 




31 : n «K f 3: GOTO 1720. 

■ In I ins 1770 I hava usfd ttift 
Tuaction VAL tje^luite 'he 
vaiL* o r f, i ahoiik of *ourt& 
have uEHd EVjsl, thersrora Lite 
1770 

ct = a - pvai MID* (Pif + 
x $ + V" + SfFlS EVAL ^n- 
+ • B)". 

■ I have omitted to return the 
pr inline width lo iis dftlai n 
valie aier a piinikig opeialion, 
therafoe imft «67f should be 
487a V0U3:\AKDTHC 

SCREEN STORE 

I r.i'.'E Sl-T'p' 1 1 la i iv proitruiii: iur the 

SptctniTo whrh *lort lhf srT«r in 
rncrtiory ard then repr nl h em rcqjwl 
vin- t|nuk v The r,.ll mmi; |iui; inn 
will dorhcsiur* thing un the fimsxad 
CI*C -1M comcwECT. I advse ihar ynu 
flntj' uk ilw io«tr» to iiore oiie 
scriefl » .hoc sctccak, hein^ nmre 
cnnple: thnn ihtir Sptcxnun emitter- 
pan*, isqiirv monr rnemery. Dm nor 
be fooltd hy tnt siar ot~ iht ro.irine as 
it Lse* JMie nf ihr pnwrrfhl franiri^ nf 
the 7--N1, that Kirinr Hi abib'ty io rrove 
block's of meiiurv abyjl. The rmime 

Will "JVC flrtv KK4H in any n-ode 

inrludi.ig colours if I hey ht lhsI, 

To -jsc the routire UHfriy I :.ill 
■: ni i 9)to nor* ii ^crerrt and tfen Cull 



KNIGHT LORE-UNLIMITED LIVES 



ONE POKG FOQr*t ¥C' tWp 
AST TMMEK&ti *W« 





I'M WKITIKG to you because after spending two hauis totally 
joliiec hackuig my vwrj lhrough over 1QK of machine cede I cui 
iinaliy rcvtal i way of making; Lik.Tnate's masttrpicre Knight Lo:e 
ettier. 

Just load the code from tape, entir Fokt 51567,0 and rnr. it 'jsing. 
USR, Ndw play the gathc and — surprise! - vou won't lose any 
iives. 

I can also reveal how to frrtisl ]« Set Willy easily. I-nad the code 
jSMig C1«j- 33767: Load ""Code and antw Poke 11083,355: Print 

USR 337^2. There will be ju« one object ,n the blouse — b Lhv 
ratfiroom — $0 pids it up ant go to bed. 

Pcdn Ftrmndts, 
Portugal, 



iudl to rirrint it. The rouiine is 
^pR'ulk 1 lurltil when chann'ni: mede 
ificr drjwtni; n conutcx Krixn- know- 

n^ rhat remrniDjj Id ihjl s-ifrw- «cn*-ji 
*'ill retpjirr Iccitnu reJriiuiny of il. 
'-ZaTt should be talcn xrt to jet. the 

00 number mbtcd up as zallirsg ihe 
itort routine nstead of the draw 
■online will result in the pjcdHibi 
icre*n beiof ref lacol w th whatever is 
>il the xran al thi Lime o.'i'h* <Ml. 

T/pt in ihe protram a» below Mit 
*)iLti yuu have L«led it vou may save 
i in ihtrnchod deiatccd an cage '12 
:>f ih« i iutiujI. Once ihc rjuiinc ha« 
seer, sated m tie form of byte* il (an 
>e loaded and aJdcd io your pfOKram 
ju i ^ ii.vu 
td LET ad =24590. 
30 FOR n = 70 S4;flEAD a:POKE 

30 HEW Pnnt = od ' StOf* 

= ad+ 
*0 DATA ftf3 ,33 ,00,96,1 7,00, 1 92, 

i 1 B 8, &F3 .33 H 0O. 1 « . 1 7 J0O.96. 

0.0,',00 64.ied.e;bC,Afb,2Q1 

WehBK Park, 

OHM 

ERROR NEWS 

Tlll.M.1- HASbvca an error ir.theanidt 
with ni H program Nevsmongsr. *\v\ 

■njxHlail Fokt tuximiind lu> been 
>mmed and (acre was a misprint. 
Aflsr lhf xattSOt Poke 1651 1 M N/1. 

hcrt should be pmred: 

POKE16£t2.2NfL 
ind you htve ;reaitd Hue with ;=. 
Rem eoitai Wf. 576 bjtet. 

fMond 

"BBC IS BEST" 

1 RE£D cmi 5UB1C JHU$CJTKJM StCVOl 

Hill's ,inswef io ,i reader's Icocr 

ciuiLzrriiiiu ihe QL uid BBC, Havns 
used hn r h nachnr* where 1 wort 1 

!..■.-: ! t.'iiii i-d ihc M- ■■' ■! ■iI'iij'Il: 

For a stan the cUim Ifaai the QjL'i 
p;rap-iics ajrc fbtu- tines faster ihmi the 
BBC's ii tM.llMU4iie- FLiliyp* jMi Hill 

mad* ar. «"ot wd read his dine la 
days instead orsuconds, breauRe die 
KHC r s praptics and Mastc in t;ene~al 
ire much ftster thtti tbe Qt >. 'Ihe 
irroHiru; is » cate ia. pr inr. Although 
ihe QL's Pm aid SctaU conuntrxJB 
sre easier o nse thai rhe HHCs 

VPPUj the latt*r'i scrolling ik 

milantancoLS cue to il* hatdwirf 
nature. The QL iero)lin{: is very 
dug^iah uic in Arder ie» acUevr sent 
temWancc oTsir.ooiiineis the uier has 
to rufuri to madtinc code- 
Haw do you do that:" hasy on a 
BBC, tit ejicelleiil buil>in as>»mb.er 
allovs aj>utihl7 mnenoncit io he 
oibttd *ith Basic. QL uctf wi I lia^e 
[tToHems. 

As tor rhe '''^uTfiartdirS!. 1 Icthnn-.d 

Khitventtnt" inc. Mr Hifl I-dr 

(continued on page 27} 



VO'JR CQMPUTR. MARCH 1985 25 




50/0ff 



Gioamic 



Many of the top cassette based titles 

for ail the popular makes cf comp jt- 

ers offered with over 50% discount. 

No massing, full mnnfiy hack guarantee if not highly delighted. 

SEND FOR FREE descriptive brochure on all itles available. 



EjJl 
C 



i - 
UsrjPmit' 

Cr.ctn 

LUC 

dLEtsiL-a 

*. iiiii i • 



CAJSETWM 

PFDnn 

FHEUMC 

LIU JM* Lfc*l*H 

■' - -!' ■'. :\ 

UIJ51C PRnCP^S- 'F 

CMCNOM 
riFVOi *r«---< 



9 9b 
» w 

TW 
/ ss 
j :>] 
5 SI 
I(H 
I 4 IE 
j "IS 
7 OS 
-. lb 



=\Rfi A - Fr.Tnniv 



'ntsrj.MLWf 



OMMODOPiE 



Snnxi 
Anng 
&F*r33. 

;:". 

CFtl 

GoMttVllNat 

■-■ |' l 

lTa|inc 
>-^ICK>^rt□ , 

Irleircnl^i 
MtlkiuniHaj'ri ID 



MfTHiPnwii 

1=1 -_r . r 
IftfilM 

Qui^si V 
UartUM 
GulzirjIVa 






Thf 
Vircr 
Virgn 



JO ^O 
U1<!0'H3H 
«TCM 
*iF*0- "-'.•' 

.k wycnv 

■V-IFI YElRn 

SPtentLfL 

SWAi 

SCflHi. 

COSVICSRuiSEfl 

Wl LUL jVLUMLS 
IlL.'.HSir.MOVSNfuH- 
HLTJ^CE [iti^ i* Tli 
F,iv>np 

itTj.rK-Mktvrj*;r* f 

i"Ji FF.T ^"IT .->F "iFk SIP FT.i=N 

tht sore E nFns »ppn f it - _ f 

AOJAPlSHE: 

DOKAEOCHCr-.fii, 

IM.'J 

'TIT' 

M.rJTFfl 

5i,°f*i *Krt*tfli f 

".. HI. *,'-'>; 

; ■- ::tjru*i 

AMJUJi- 

I ii-^urii" i !■■ A 



COMMODORE A \MC 20 



'Vrtig. 
.!,' nr 

ITUVP 
. I,, ,, 



M 

<* 

H 
•4 

H 

S3 Pl-jurj 



i .J! I ■ igpvfy 

CASSETTE sa 

■ ICHM 
CC!HHIL;rj*.:JF^ 



> ■-■ ■ 
)w, 

S9l 
■' b. 
7T| 
71'i 
"Ti 
?<K 
■'93 
l<4 
L.1.J 
L. L.I 
'UJ 

r -aj 

SHI 

sn= 
4 si 

F5> 
*0J 

in 

■Si 
.■■.-: 

r.as 
'•'i: 
<=?-> 

75S 

■ s 
u« 



■ '. 
kit 

■ '-, 
5 S3 

i a 

M3 



1 49 

2 :j 

J 50 

17* 
171 

3..M 
3.21 
7*1 
7 H 
17. 
S.11 
}» 
3.3* 



CM 



4.39 

:n 

in 

in 

3.71 

IF! 
3.7] 
3Ji 

3.59 

in 
34a 

3,l» 
<H 

4.» 
in 

4.» 
3.31 

.1.-- 
3.79 
tTS 

Ml 

i« 

E.» 



3 }9 
3 t* 
**) 
3.W 
2J1 

9U» 



iPl 
:pl 

*Sl 

•r.Fii 
:pl 

-r,Hi| 

:. ■ r^i.n 

JKIranif 
I KfTFir.- 

5j.'rti. Mri:.'i i-< 

Bjj r, r--, li ■ 

liunr- 

IMHIJMI 

Ir^i^ir" 
IClMcrsr 

»lEbai rrw l^jij'^ 
MelbciriEk'ijW' 

Koai 

■ T - - 

£1 11 Kxlv^ 
1>J C> Jf* 9 

Qjicrtsiva 
iJj-:Hiu 
ajKimva 
'■' 3n 

>l'l]|r 

7iinnii 



Ha Tlu 



BE' 5. It 

inn Vj| nn 
E [ 



K*Nnrjj" "jni f 

HI VhJFII^r. 

riAf-rru^rtu, 
'HECMEG^P'JN 

11-F nisrjnm/*F.iF3 

SPFFini.Fi 

7ir,7-". 

SKVL: 

t"l*FTfiJ 

■v;liiil 
cmkcc'uisep. 

Mb L^ :■ 

WKKM0OM 

uuaav 

F=MFTFJ1.T1FI 
DF^T-CHWF 
^HNFF-F UHfil FH 
F.^IHTlFMiir 
0HLl=JNFr.D i 
uirrih;4i f«t 
.OEISV.'.D 
^ihJT ^i"^r*u^ 

lic-JOiMiOa 1 h£*-u;a 

FFIiD 

« L*EjFFu^^^= 

I DO F.Snu'.MAH 

ins TC'":rri 1 

1!) ilJ 



" ■'■ 
i(M 
tOf 
}jf 
Si 91 
7 M 
? VI 
= S^ 

IM 

it° 
UK.' 
SCO 
LiL.3 

tst 

------ 

-,l« 

isi 

-, j. 
-. j 1 
l«t 

t-W 

I T. 

SIS 
SIS 

-. J- 

E.3S 
■. v> 
5 HI 



341 

ut 

jUf 
Irt 
i.l* 

314 
?■? 
3.1* 

J ■? 

tin 

J 9 

3JI 

.'in 
Wl 
3JO 
7M 

IM 
IM 
IM 

3H 
j -v 

J.T 

3.»S 
JTf 
J» 

3!t 



>rir&j 
I. i.^^i 

Irppr* 

Mmmtai 

ll^-TTPl-Ji 

'I'DPl^ 

brictyiM 

OmUmn 

■j i.:--j-.i 
"nirtr^ 

"h M 

'"• 11 _ 

-■■ai 

net 

'Hi 

lira r, 



1P5 yw 

IL79 CHWKUB6 

1m vnHiQ*.v:'Lthi 

IM K.S1 1 '.i«i I ?si --Mt-r-L^. «1 

iij rviiBFPJkrF.F-niiiFn 

111 THPWl-OD 

-"* r.niKicn 

II ( PlIiliiLL WiZJsPC 

11' UhHrWUU. 

III 3t Sii>SOHFISH 
I'T LLv LJIi 

l» O.lv 

111 CflrF=r^!- 

UP SNfirn-FR 



ORIC-ATM03 



ELECTRON 



MrnFi*«| M HFviw 

L;llluft<i SS ^C-NNfFlfS 

u**FHl*n H fC.IHNT-lcF^T'T--* 

IT BUGS 

SlApur SI H*JU 



S ■ ].«B 

«(t I'M 

«B 3.!i 

•0 !|i» 



SPECTRUM 



4,1 mfj « «Tffl 

MMI •* PH.HtJllf1Ul.llLr 

tmm ii iw Pfliw 

Jkn.l 13 UF>Mtlr/3$^UNr31V 

. 1 |i'iyi- ej i^m'FnFiKT^f^Pn 

tun '.'7k W £CupO:<k«0k 

■■-■.i.- «a fSSETTtse 

CIH IT ■A-'hilU'r , '*K.UH|.V 

rm h sr^orsHrinTpo 

rjP 41 44JHII' 



SF£l 
HIT: 

«.X 

afe 
Lit 
«nf> 
!LV 



ta 
hi 
f« 

171 
lit 
(.t» 
■ It 
lit 
I.tl 
3.H 
1.19 



■am 

3JMHI 

I itniiHf 
• ."i— 

I^S 
Snrrn 

^ll^iun 
■ i-.i. 
^■■i.n-.- 
"1 i-t 
liliv 



m ^^■■J^'^^■>^^i-T*^ 

if* hJinriFriiTi'^v 

17s sr.iF^mv- 

im Ciimrn 

tor sjKmxYViHsiuri 

l.-M • 

I» F.I-..MMI-I- 

1H '-!■•■. 

Ill IflfS-Pifi^wnjV^TFFl 



■• H' 
i; h'. 

9.99 

ii :■:! 

Bte 

E3D 
d :rv 
*t$ 
7ffS 

u.» 

1. a 
in 

srF= 

BBS 
sin 

5-W 
i". 



., ri 

■5P3 
f. 11 

tH 

-. u 



1H 
■ il 

sin 

MI 

311 
j,m 

m 
in 

3.F» 

>:> 
LB 
IM 
3.1* 
tMt 

tf» 

IN 



tit 

in 

3» 

)» 
31* 
IM 

.1 :-' 
:--« 
■ ■-j 



IS U-£p3M(3ut« 

113 ilF:iNii*nr/is 

m Osstfl*ujLf; 

13, UJ-JuHijUiiLH 

1*S 'iALW*JnlHJHlW 



I II, 



1JH 

111 
HI 
141 



A VIS 1H An 



tin Ti.1 raw*' 

^IMIpl 


1|7 

IH 


OltX«.S 
STAPEQMVIAIVCO 


M-.- 


HI 

■ 13 


ttp 


131 
lit 


L,LH - ll.|r 


■l-l 1 


IM 


m 








I'll 




1 



!=!»??? 



PiuduL II 

A:aiE-i1 
^ir.rxia-*! 
■ ,, , H b 

1 i ,..- 

AliJM* 
*bv»'^ 

"r-'H 
^ 'ya'a 

Alkali 

IJ.^L--- 
ltvl!L> 

I rr m • 1 

Ui.mPiihK 

rJirii'.^i*n 

VirlU PP*f 

rJiiT^fSiiiiFr 

'■'vn.'P'p^ir 

Pbirn 
FMil- 
&4pMr 
■' 1 * ■ 1 1 

■:,-,, 

'KBjr"!- 

a Mm 



I5.P El* 
t 



1*1 L +'J tNAKLK 

UJ H3FJr,3KfFk 

141 I ?=TI3 -r* HIT 

rii tv.iuH-rr.m.'-Fr 

Hi ruWPIPl.LPEP 

lit r*JULl.l--Jli'LLI- 

U7 ■ .mi F flT'kiT-Nl Ij^F 

i« WHrrsiNnips™.™?; 

lit r.H*n-FM iFJTFfl 

ISO POI^lf AW.'Fh,T"lrFtF 

|J1 SC"JCFf*1 *".f.- 7 

111 irTTTnilT.OF'T'ilU'jMiTlOE 

iw stwsi- r> riGoovrriv 

ill TAHZ/N 

IM U , JL.L U .:'L*IL'L 

isc KVTHKrM-jOsivi'.'^iLt^ 

IS7 CtlOSSiAL «OWE«TUFtt 

ISA IHPrjSDFTMF 

■ e ;■ "•/*=!! 1 

1 ec r'^^ ,: l1^5^.^iTJ^]^ 

!&1 CVFIFFiTFiiiTaUIFISinh 

ilia r>*- *vr,rir.fnw«»hrjFi 

IU r*0L.5. 

iW ^EPT-M-AtTu: TTUCalU 

i45 I.KLEEC^JILL* 

1 DO 9"! OC-i C l*F" 

-*.: ■|ILI-! LJ I ■'■■ T- 

r» IrHDM-W- <^t f 

ISA HilkCtEACK 

I7D FV.'F HRi^lVF 

171 s"*ni'TmKTr* 

<7J WJUL*FjY 

l?l li*flE^Cwl.rH:hNI!> 

Irt tfiOOtEfl 

"■• li'.' I H.T-. ■! I' 



ELECTRON 



Aiqala. 
^ric. Ilhp.i 

-T.T.. 

"•,!■• •' 

"liin* 



ITU CX riCfl Ar rV&S 

ITT K-VWitK ■ 

[Ti BlvHlrCf] 

ITS H^dCFewn 

■'■■'. Hieis FmF*( in 

■ if 'Tr.MKM\F>ji-"n 

ti-t FHFnF.niF met 

113 crfH.PH.L'R 

IH IJ-IFHI Al > AO 

114 Pl»*Vli 



SPEC-RUM 



ALF 

Anc 

Mr. 

Mf. 

|.i:r.-..i' 
Nn"viF 

rliljUTt 

rJjaEryli 

B.-DtV* 

9,1;^' 

t'rjkfl 

aunH 



. JL . i. 
.-.,,,-,. 
htuwiu- 
■Ir^*" 
L:ml| 

um 
l^rni 

.l|FUJn,f 
I -'.r,,,-. 
: ■! ,,. 
F>-i ■) lli"i 
I-. . ,,. 



H 



30 
111 

■'.' 
It) 

.'.1 

its 
IJI. 
I IT 
l?D 
l»» 

FO. 

m 

H) 

■ '■< 
30i 

Mi 

107 
Ml 

rot 

<i« 
111 
VJ 

111 

-311 

ii* 

311 



;f' v i-kif Fit. 
rF,r.ii,"F.Tn im»Ti' 

1 LfJIP-V'SThCCuPDEI 
1 ,1m 1 . ul. i.- .■■■•'■ 

I 111 "Ml • 1 •! 

'i-i.IFL JL'JIt'.TJ'IMUL 

II •-■ is 1 ji- Mi-r. .I'll 
FUVtT-OT 

■rrn Vil*ll 

w**iir mikF* 
h50t 

lMP9CMJ.>t^ 
ITJWWBiP 

T^.l7JI.INi J L'iJWX L LL' 
r ^,nl*h filial 
I ■',Hli.l,rji|hF 

ni^nr r\ *r'*fj« 

SCJuHEnYf 
l'UNIU<S 

Pr}*6I.VifWllJBtNB 
•T1FH 

1-tW9fiWW 
«H015*L tOiflwriMf 
; t . «r 

VHOADmLL 
■ftrtrl (ONUlM^. 

K)hf40Nl"iTC(i|SCtP( 
SVtCtM.C3r%LK*IHJh 

mvw^osi 

M!t3**U.1i«HlUi1 



19S 
lac 

**s 
in 

IH 

'. ■--, 
US 

:« 
;« 
■« 

,fi 
;*i 

.■ft 
IM 
in 

IH 

:*s 
i» 
7« 
*M 
fn 
, j.. 
IM 
i»l 
:« 
;as 
;*s 
;« 

■ Tj 
IH 

III 



:« 
i* 
i« 
i*n 
i» 
til 
■i '3 

in 

7 9! 



f« 

• •-- 
rut 
tn 
i*s 

bit 
-.J5 

'SI 
1*4 

IK 

;m 

7« 

>V3 
IM 

rr 

I" 

left 
■ ■* 
t» 
"•» 
»H 
-« 
1*1 
1. J 1 . 



4* 

t,M 
4*1 
IM 
!•■ 

I B 

•SJi 
IM 

4-tt 
*Tt 
' >l 

».n 
in 
in 
B.11 

sa 
IM 

S^ 

in 

>■ 

I'H 

IM 

IM 

3_H 
34 

i» 
.1* 
IM 
Ul 
in 
1 1:< 



■ i". 
iit 
Ml 

1-31 

as 

I.S 
19 

u 

3.B 
171 



l.Tt 

ir» 
ad 

T.4l 

ii» 

J7> 
.' .V 

171 
4.11 
*M 
V* 

t.m 

IM 
Lit 

t.m 

iM 

IM 
13* 
11 
SJt 
ITT 

IM 
2.YI 

J.fl 
IM 



********•*+** TRADE AND EXPORT ENQUIRIES WELCOME *•+*****•**•• 




SOFTWARE PRIORITY ORDER FORM 

Please rush h n&; 

FREE , L1esc^iptive , cataogue (please tieki YES □ NO □ 

CoripLSer !f\ak? a/Yi rrvxiot Pojiage ana P^cHing FREE win orAersover £10 

Trir? ttXowitg s/'.'es tcn'olc Item numbs'? 

Stem No. UnlPrce Qutimf To;al PlGasolindefifCoscdlulremilȣnceo<C 

Please deo I iny Aooesf'Ba darjicafd No 




01 446 5648 




rCTAl 



Sigialu-c 
Nam* .. 
Addrtss 



Tel No 



PHILIPS & PHILIPS CO LTD Schptomatic House, TDrrington Park. Finchley. _ondon N12 9QL 



26 tOU^CDMPUTER. MARCH 19S5 



^^^^^^— 



IN* 
TOUCH 

How to write 
lor Your 
Computer 

We Calted this magazine 
Yow Comput&r precise y 
because we welcome your 
views, itps and Nuts ard 
t>v«n ycur crtticlAmia nf 
machines and software in 
general. Here's how you .go 
cbojl getting your name 
hto print, four article 
should be typsd, doubfe- 
ipcWtsU, uii A^- ptiptir. A 
name and adores s on eacf- 
sheet would help. Don "I 
forget to tell us which 
machine it runs on, With 
proorans please include a 
cassette or disc ant seme 
indication of how log I is. 
Please put what machine 
it'a ; or on the envelope 
Don't forget Ml 
tnat'uc:ior& lo u?i how to 
bad and list your program 
and how to enter it for lhe 
feacers, 

Tefsoft 

Tel sol t is Your Canpvier's 

software downloading 
service, Anv program for 
the Spectrum or the BBC — 
and soon Ihe Comrrodore 
— which has s telephone 

symbol next to It Is 
available en tne aertlce. 
Doth 1200 and 300 baud 
speeds are catered for. For 
more dstails call Cd Chester 
(tKQfy BOtiB. No more lonely 
nights typing in endless 
paass of hex digits. 



Message 
service 

You can gst messages to 
us in two ways. Either u&e 
i he Prestel Telex Lhk :o 
&920S4 QISPRES G Or you 
can us? our bery ov-n 
modem, day or night on 
01-661 S97&. The modem is 
V21, 30O baud, even parity, 
10 bits pe' character. You 
simply traisnl! In upper 
cas^ "YRG" — our ad cress 
code, and wait for tie 
acceptance code "v+;'+ 
STF GO", Then off you go. 
Dor't forget to tell us whe 
it's for Sign off with 
"NNNH" — sgain in uppe- 
cass, 



'continued from page 25) 
ohvousiy never looked mxlcnuauh a 
BBC Micro, Will" it* muhiiitle of 
.menaces and purls lh: HBO alkiws 
lie com«f:«n of »intally swiy ptri* 
pticro! 

The BBC beats the QL k oticr 
areas ItJo — bctltr sound; hififlcf 
resolution, better kcybotrd, m,*rc 
rcli: hie more inbull festu-es sue)- » 
interrupt swftwire- met 8»n rauU<iec 
and much heltf afie--«ile* wrVCe. 

Hitf Ei-Ann 1 , 

DIGGER DIG 

In Monsfep Digger - Kuqr 

Cmiipuwr, Dcccmncr 19B4* — the 
author, Miihacl l'ikc, warns against 
typing .n the line number oi the line 

jlllHlttliltvlj iliiCl the Hcoi iB l ii> if ill 

muse Sac lo be listed over and wet 
aij>iifl, 1 1 e .isCfi^i*- 1 hi st l< » it ' 'htig irt the 

KwtiL". u ts i touting of [lie son atw is, 
in fact. The racrmal rt&pon&e of ihe 
ZX-Ml when vcu Poke an i nooriect 
line length info a program lint. 

The nine Rein statements is de$- 
rrihpid frir Imps I Pi 4 — Ifl Fill linp* 

of leroes — would each consist of 
Ren fcllowcd by 514— not S20 - 

tcrccsj and coe.i line would contain a, 
Krictl o\ 32J brtes mtdc up uf line 
I number, lire Icngrb, Rem, 314 Kernes 
suit) Ntwllne. Combining, that nitie 
lint* in - o j single Rem Aiii'emrtii will 
produce a |iM coi Haiti 11 ij 2S7a bjits 
— nor 2HU- as sialad n the jinicli — 
■M\d (tiiN Mill be tclikved ';■■>• 1'iV.:- 




16511,60; Pgke 165,2,11. 

If an invalid line Icnph is Poked 
into ItfilitU, Uicn repetitive listing 
of the Min :tcscribtd will occur oti 
aTten.jiiLi.g u delete the fcllowinp; lire. 
I- is probably wonti checking, when 
csmhiiiicg lilies in i.m way. th;t: 
PRIM PEEK m5l2 + PECK 16511 
+ 2b6 * PEEK 16*12} 
il^re pivc the correct acswer l!B fix 
I he Nnwline ihatann* at rhp Fnd erf th^ 
Imr. 

Sumy. 

ASCII FILES 

I RBCBNtLV ii au contact wi'h Sindar 
Resesrtl: refistrdiriti; a particular 
phenimainn with ihc QL and Micro 
drivts. 1 hid iTwitd and saved a 
ITsngTum onto Microdrive and, on 
reading the number jf scctO'S ujed — 
Tumcly 42, jssumed iha 1 iht prngrm 
vas 21K in length. However, wli^i 
the .irocjani w. l js oaded h.i.i, :hc 
Ea^c pointei had niuveil hulfas uiurh 



CORRECTIONS 

Lines 2266 lo 223* snd ine2ia5 
ws i-esFt out oi the HsilnflfcrMars 
Buqpv in the = Btruary issue. 
Thoy arctjiV'in bolow. Enter if* 

Itiltcnp In uppor oflOJ. 

2267 ftWt,'fct«, ^-66.06,56,60 
t^t* aa7jtt, l -t,ui,tc.a5.W3.tc,ee 
226$ iita7c,te,c9,c*,tfB.e€,?o,S8 

2271 istj7e,f*.cft,tE,c*,ee,7ie,« 

S?a datj7*,*e,ee,'f£.c.e.ofl.Ga.«e 

2:71 iati7c,*i-cfc.M.iifi.e*.7e,ftB 
227* I»ttt€.,e£,ai,*e,c6.e6,es,ie 
2273 iat.?Jc,>3,3e.3£.39.30.-fc,90 
2276 iat§7e,3i,ec,0c,0e.u:,38,»B 

3S90 djtii.-n-;y-L«, k H ,!=>■.■ *-J.. r e.AJ 
2279 B*.ti44,##,-f* f ote,o6,e*,e* J *e 
iiae aati«,Td,«r«,*e,e6,4fr,«t 
2281 d4ti7e,*6,s£-tf,e6,e£-7c,»B 



2232 dit*?c, 
2Z£3 <J*t9?c. 

2285 di'iV 
2286da.t*f* 
SB? 441*+* 

22133 dit^aa 

£739 da-tug 

l23A (Jataoti 

2231 d»t*£ 

2232 dat*44 

223^ <l*ti*ft 



*6.rC 
c6,r6* 

..:■■■• fV 

95 -IP 

«jC,u6 

a£,e£ 

ia«M 



■I ;.#*.*& 68, W 

rt.6ii3c;esiee 

■+t,Bi,e6»7ie.ea 
IS. 18- IS, 18, 80 

*xt , w , Ww, 8@ , 8@ 
c6,^,7e,3S80 

IS, 3s, -66. 66, 88 

T+ I OT I TT, B8 . TT 



218S data3e.eH,ac,^,0J,k>9,98 48 
In the same issue 'he im loader 
Tor Spectrum Synsounnr, ,-nrl 
Spiavmania cantems g. few 6f- 
rorf . Tc co r ract it nssrt lines 75 
and 1 T &, and ctiange ine n>: 
75 LE"x=0 
lDOPO<E i + t,2 
1 1 S LE~ x = x - 1 



ajsiin, sonve 31 K. The explanuion 
wis hach as iblli wi: 

"A program is iai-cd on Microdrive 
at an ASCII lilc, therefore vhen il is 

ftiaded it is inkenbed and rnitine 
an.drciicd appended. Kor ifKiLnpt;, tlic 
ward Print (fsve h\res) is iokeni$eit 
into .■■.'.!.' b>tes, pl'ib a lour byte 

tKfifsn lucoi > du tAli j jylt ia un.d. 

Ir fan. i Jifpcafs thai the user brs 

S6K byi« available Tor ■srograni siic 
j\ lnii(" ie no rit* tfwnrxls are used 
and ctoain prim aptbtts not used." 
Vou can biild i piogrim j> a data 
file, and iJ m< line numbers are used 
and i he file is LRun, the program 
runs, sut cannot be listed — nolhin; 
lo list, To do this create the foilow- 
inc piogrim: 

1 INPUT NAME', m<t% 

2 OPEN-NEW #b:'rtidvl--aHI&S 
4 FtEPeat buld 

Fi lNH.lt I $-1- I. s. 'STOP'iEXIT 

bclfd 

6 PRINT #5L$ 

7 END REPBil till Id 

8 CI0J6 *■ 5 

N(ne lirie 5, tin points, the Irsi k 
tlie dinuble - ,lJiiv Dialt* iliv eillry ta*: 
indeptndem, and secondly, ;i colon 
cai b* usid wiskad of Tluat, If yon 

tun the .tiijjjjui ,ji,h4 ui cijtuul; 

ilDUt Ihe folluwiii^; 

PspafO: INK6r ds 

FN i.ulrvle ' 00,30,50.1 ill O 

Stop 

ard you called the file "^Bt ,J ; if j'o» 

t.run mch-l-i«t a filled cLcle will 

appear. Tliis idea an: be extended; 

1 INPUT "NAME 1 , filsS 

2 OP IH -NEW #5; , ntd¥f'SlileS 

3 lno=l0 

4 RtEPeal build 

5 INFUT( noj, 1 ;UI;if LS - = STOP : 
EXIT build 

6 PRINT #S;lno J - "Ui: 
lno-lro + 10 

7 END RiPsat tuile 

8 Close # 5 

€ MRUN'md'-'l ' ^ilcs 

Vonr program is tadwl atMP die 

end of (lifei one, 

B G Qxrthik 

AvltSMlf\ 




"THE DRAGON ISN'T PUFFED OUT" 

ONR WONDERS tvherc the sufiwart houses hii.k art DrjK<»fi 
owrers hat-c tjone 10, When the: laaiiufaciurei goes bast and is 
solcf qITio so^jc Spjnish company,, the hapless computer owner 
Jutsji'i iliiuw liis ujacbiiicr .n ilitr bin mid rcpiucc it with the fatCJl 
otlertnf . No, he tames on as hoiiilliI 

"Ihereisiioahetiiiti^. I:i tbccwworitic Dratjiir, the compuwr 
rtjjrt^oitK a capital cost of somewhere between jflSfJ ar.d i!23u, 
ilepcndin(j on th? time of purchase and the model 

Second, there is no Obviously better computer, I t™n a Dragctl 
fA running t-n Q&9, This Uuix-bcstd, multitasking operjtir.g 
jysicm has no eciuii in the jornc compu'er world. tHinp the 
itylograph w->rd processor I :an do in 20 second hat ii nmk 
Kalhleen Pee. over lhic: tninuttistti do usinj Quill on a QL. 

W&sdo\ i. 



TOUR COMPUTER, MARCH 19S3 27 




Pngramrcahle 
Joystick interface Inr 
Ihe Spectrum 

£19.95 





Sir* ata "Atl c (up «wr- 14 

"?tl( Iw Uala-lpO- U> CUVO'l 

Lamar L rt -j<I.' 



hi iv*i1*<Ti ,T iMrn Wir"i 

*3^*:-i jirf CaT*tJ-w; iQ'trrf-. v*ilf 
-.":.. ri .mil m«- rn 1m ill m* r <- 

*lJ4»JlH>ii 

CofTvintrr .yi'f ii ft'ji- i^pf 

iiW"" m rt I : i ii r ww II 

|W1 ttniUl IL'llJI -H < ' ■ ■ 

I 1 1 ■'! 1 ■ . ' ■. 1 1 . . '.' i ■ [14*41 btl 

-ii ■• r [iM:1 Ji.ViH «liul LlJI'l 
It*' >» v. !■* f t MU<AI N l^f r 4 
i'dlllfl 



OUICKSHOr 2+2JOVS T I C K 



nnrliMt l> KIRillwaiD 
mQ ii i*|.i3 '* -?t> >D" 



£13.95 

K) VAT jiilPAl 1 



Fl JfiHT! IMK ,1(1 •/S T I HE £4fL gQ 



■d v* I m*l ■" A I" 



CUFRftM JJSPEECH L'NH |"7Q fig 

• ■, '■' ■ • T m J P i P 



Cosier bnquitioi VWftlecmft 

Plan; Hirilow (0!:84|. 4894 



ALSO AV-\ILABLt l-HOM 
SELECTED RETAIL 

OUTLETS 



FREL LTD. 



Hocke>i Mi IK T"en*ntte. 
Lucko* Shfomhu; S v IPO 



\l- M i V.H, 



*dJ"*M 



I- .ilujt . 



Of> 



tcxJc 



ILcm 



rtunNce 



01 Cnffmn im«i' ih 
■ 

G? KlifhllKii Jot i1i<*. 

01 Cl.in»ihot ?»J JuMLck 



i .iv,-: 



■i<CIU rf 



~ nl.tti 



01 



0u-im:un > tluckihjl ?■? 
Cdereen ■ r h- r -:ii'i.. 
riuwh .ii 



■ i3i.ni 



>£».* 



w I /*■ ft. 



Tolal f 



"I'vV 4 tiru^ hVT'l^ 



.,...1. 



"1-61 (.TO v 



1 



iiiiii 



Educational Software LCL 



MICRO 

ENGLISH 







J 




%i 



^ 



BBC Micro 

T,^«, 40'BO truck n.->r. 
FuuncL <jDinrj|it!|j>2, 

ZX Spectrum 
Commodore 64 
Election 

unexpended Vie 
ZX81. Apple* PET f£\ 
*N.E.C. PC. 8201A*^ 
Dragon (bock only* 
All software for the 
above computfirs. 

MICRO tNCLISH (BfC, Elirtifonl. ConplftW Enjdil Langua 1 4 id ' 1 m .n 

jic faviiiDH LoiiM, 1i> (J I ctrl, of 2* ^raifn-nt Inckda* "mfctt-itid 

•iptli ' rial tpsetTi [no n* j as foquftqaJI, CU.tjO 

MICRO MATHS Z4 ilrutrlirti IOVH9(V nr Ifrlf-HJUml r.cu-"5C to U-Lf tfls' 

t2*,S0 IdKC-jrtt ZXB1 EM 00). 

Sin FtlANCS DRAKE ADY6NTURE GAME. Auneni.f, hiiw caL sjfiph.cx 

aC^V4illlLI'! IJilimj. I *3 50 

ANIMATED ARITHMiTIC I -. .1., 1 1 ■ yi ii^iip mflirn^ Lb^wUI ^k,lJvi lntil 
wo-il!l Agn; 3-t. £E &0 Idnni £7 &D1. 

BAM NT EASE AS Q«OK Or 10 IMi* S pjiil* pogrima. ft. 36 
'. .sicetfwl'-EOtCATIOH^LCOMPUTlVQ. 

J lmm«ui0 chipalch Wr:ro Maif*. lActo English «n# rVlnler M.«H? 
Phcnaci said npfif k<m- 't%i«ii* 1st lit* *>|iibi1ionlnflfl*( r30Oin.nfr.mal 
id; 

LCL 

26 Avandale Ave, 
Staines, Middx, 

Tel: 0784 58771 

24 tin i Oid«iB, 






r» 




TftAOf JtSCCWHtTS 



■ASSMtlON* 
TV 




26 VOUR COMPUTER, MARCH r £85 



I could 
do 

tndf««o 



January's problem asked 
yiii in wrllft n i0 line 

program whicn caaedan 
interesting or art silc 
pattern. We awardfld the 
£15 sn» to P. Duyvesteyn, 
Wijnmtlqaarde 30, 3436 HR 
MgLwegen, l he 
Netherlancs. His program 
is wilt en in Simons Basic 
for tne Commodore 64. 

It allcws you lo create a 
variety ol dillerenl pattern* 
by a lenng a few 
parameters. Adapting it to 
run Other machine* *hOwld 

not prove too dill icUI. You 
Mill iesd to change line 
1F0 which takes :wc pairs 
Of coordinates and draws a 

line between ihem. The 
Commodore 64 has a 
reaotutian of 320 by ZOO so 
the liourc-s 163 and 100 
position the pattern in the 
centre oMhe screen, 

For this month's 

compel lion we would like 
you to write a program 
uihich modifies iIjmjII, To 
do this you will need to 
find on l haw you* version 
or basic stores its program 
lines, and you wl I 
undoubtedly have to use 
P&eK.s and Po«;es. 

Programming purists will 
tell you that ■self-Tiodifvinc 
cade is a "dirty" 
programming technique. 
But i can produce aorrw 
entertaining effects such 
m a program lha: e>terds 
itsett by a given number ol 
Mies every time it is run. 
Your program should nol 
have more than 20 singe 
statement Ines. 



IH TMpUT'l^.i.ii ij - 

IH-Ur -iRHTh Of LtWiTl ,IJ 

j La TNfLrriMKiLE i*. 

IMiii ji.-jyi, ;.i t-\, i .ui 

17! II* Ur 'yVK " a 1ILH.S 'III 

r#ui vi(ThT»s MLI ;■*{„. 

14) : 

"i|ft£i|.» 

l» innmf«v trip w irW'iw 

it* i >i| ilipitrpc<lClf ! NU'Hirt} 

:Y|fltn,«iH;iiij nn>«min"t 

Tr-IM S,l 

IH .!Lj.'(*jtT,*nH[,W<l.i#hB:>»**™,t! 

■ iiuHo* Hpn 

2a» UTOZ*a 








£5 I ;;;-:.:v-: •:;:;■;;;'.- 




Starting out in home 

computing? First Bytes 

is for you. Just write to 

Your Computer with any hardware or software 

problems, no matter how small nr simple. 



to* 



^ 






j 



®& 



¥£S, MM OUT OF T£# 

cp/n PHCfcfiQes 

CAN'T TSLU Tff£ 
7>/FF£fi>EMC£.. 



r L 



^ 



MfZWe^ 



What does 
CP/M do? 

OpSMTOG SYSTEM! mrc discussed 
ii January *i Fir ji B-ics where it was 

oipLincti how [her tjuicJ Mti| tH 
Iv wring noise keeping fuiv. im i>. 
on a micro. Ode oJ the moil widely- 
i.msI operating sy«ten* i> CP/M, 
And for eight-bit hi-mc and bwinets 
micros ii defmiiely nil™, ihc roost 

Cr/M stauds for Control Program 
Tor MiciDcomputcn — which suns 
tip ncat'y iu5t wlui ,1 und mht'r 
■nperiiini; systems do. The Mflrv of hs 
dcwdopracM is one of ilbse fi*i:y 
liW tii«L Mietn »o CKunen in iht 
rrtagtt: wnrld ot'mic-Qs. 

CP/M w» wriuon because Irs. m- 
venror, t'p.iry Ki;i!:il: h wanted rgho»k 
up some eaiSy tloppy due drives ;o 
in CQiuAy orlj eir.hi*hiE miii,:iopro- 
c^sicr sjstcm. In those faruiT early 
duys of mkros — hai is abcut 
^r;^^^ ,n:<. — if you warned -, >:iialiini: 
likt lliii you hud lo wriic ti yoi.r.vc 1 
M'hish i* w\it young Gary d.d, ,n 

Ivl [(iiJwi vl.«J n iWl. The rusuJliBj"; 

prnd icr *js not very eej;anr, 3ui ii 

worked. 

It ociiuiie-J tu Ki1%1uill tliul ulli^i 
micro crtchumasu iliiglit be i> 

■t.-LM-J, so he mid rbe big icn-i- 



Li'^iduLlui firm Jnul, vho he o 
Mirkilfl tf»r * th<r tine, ibont h.s III- 
Ik idra. TJicj' stcjltcl aL ihc pr<posr 
icrous !H.eg;ei!Sfli tit boihrrin; to 

wirr an npereitii-if, v^yr ■ Cor a awr* 
wit-ru Aliur att, !BjM iis-lfhrtd Icl it 
K knnwnthat it thoughl mktQH WtR 

IH£TC]t j n-assin.^ E ad 

itur Like .ill ^t»d fury HOiitt, tlu- 
CP/M slury baa a happt r eadirrj — 
irmiu' i ngl Icr Intel. KildaU ins i<m 
a few »d-i ii cumpjtcr mijrannBs, 
ami mid increasing nunb«i* of hi* 
sy&ieia. 

In feci he iisinwl sciling; w r.tin? 
thai lie Kt up hi 4 nun firm. D'fuisl 
Rcsca-ch, |m to narket ind sell 
C?/M, Tocay iie is a rruki- 
tnillioniiirc, md llig irm pr«<lu<e4 4 
wiolc rarge of sofivwire proJutj, 

So why did everyone — Jiforr, i'rora 
irsel - kci sd excited ubout CJVM' 
Mostlif because ii hanpetecl to be in 
(he rijjlu place at iLk ri^bt Lime. It 
cert silly *n$\*i i srunnbigtr btattti- 
lul piscc of jroeraimiuog: even tu- 
dsy, ihc pruJuci is rwi very wp> 
friendly, ani can be t>jffli:i^lv 
otiKure. AnJ i. cria.iily vvj^n'r 
sioipl* h«dUi« of hvpc and brifJian! 
iiiifkauig: 14 h:j;iT with, Ktidall 
almost had robe roaxtd into telling i' 
in all. 

But CA'tM ofl"erq4 first the pissi- 
bility of u>iiicdii-:-drivrt wi|h one of 



the new prstosorj. Ai Jamay's at- 
riclr rrplrinerl, IrwJV ng *n*-r iw 
disci .nd i: [>|[ j[>i output or inform- 
al ion is on: of rhe primr k>bs of an 

upcuiBii f.yfiiciiv. Aimrtimes ulsv 
knmvn i\ z 4isc opera ins s»yaem. 

Uui the ftcoiid big tdvtni^e was 
thm Cl-'Moffered for he OrsJ ilnr * 
general standard ihii tvet ,\inc ldjIJ 
use lo swap discs ind ihe - efore pro- 
ljr:inis. Hriiire C1VM, Ciwrybody i^d 
eveiy I'mrufatlurLt cancoctci Their 
own u-eirl Jtui wonderful cisc 
opcratiniK s>'itcm.v 

LnlVxttiT^ireh', tiis meant taat he 
li-u-i wpk viry m\j..n Soik.cd into I.ial 
paiik-u at ^ystim, Tocny only i^isnis 
like Appte c;m still use ihcr own 

get lwav w.rh i:. P r actically everyone 
else uses one like CP.'M. 

Id this nay i Imge ibrary >f wti- 
ware n_nning undtr CP/M his liecn 

built up; it amenity stands ai ionic- 
Thirig owef 30CO pockiges. Rjnn.ng 
"u:dcr" CP/M Hmp.y neatis taat 
while ihc HlJhnlrr rrnta'ns ill -hr 

intcrsbtLJLg ]\*h Lhttt taakc it a 
shtvu-'em-np or a word-ptijcesscr. it 

ledvtia :h« oClMat dtlttli wf |Ct1.R| 

dan in and out of the micro ro he 
operating system. 

Thttrtiiiallv t then nrtcc yru have 
got a CTiM system you cm ran iay 
(oGnimjeo on pape> 5f^ 



YfjUFl COMPUTER MAfCH 1966 29 



A compact (12" x 2 W x 81 fetter qua Uty pnn ter from tbico with a bos 
oi outstanding -features at the unbelievable pries of £t 75,00 at.. VM7. 
Plugs straight into most compu^.en, with optional interface available 

for Commodore 64 and Sindair Spectrum. Compatible with BBC A or / 1 h 
B and a ny conpu ter Witt, parallel interface. * f 



• Prints 12 characters per second 
Elite Type (12 characters per inch) 

• Bi-directional printing • Logic 
seeking* Plain paper - uses your 
letter heading • Up to A4 size paper 

• Instant Uidnye ink roller 

• 96 characters, full UK ASCII code 

• SO columns * Separate power 
switch • On/off pilot lamp 



IBKO LIMITED. 181 SPRING GROVE ROAD, 
ISLEWORTH, MIDDLESEX 

TEL: 01-568 2373 Telex: 934364 



FULL 12 MONTHS 
PARTS & LABOUR 
GUARANTEE. FULL 
21-DAY MONEY SACK 
GUARANTEE FOR MAIL ORDER 
CUSTOMERS. CALLERS WELCOME 



ro Ifcto ttel Ifil Sw™ Gruve toad, Mwodt . Mufcttewt 
lease serd Jbiu LIH-1 MertlUre mddelali of ftirter ahki 

miinttrKti 




.... Ijkc Lf *- 1 etter Quality printer 
.... Pnnler <abl* tor BBC A or H 
.... Interface to- Commodore 64 
.... init4rfd(v for Sinclair Spectrum 

I enclose- a chtjqjO'F.O-ffjr £..».*...., 
iPlu,£4 50 ior post ige and packing) 
Please debil my Atu^vbdrtUytard Card 
No: 7HI i MTTl I i ht t- 
■" tdepigne yeur f red-t card crde* 

ALlCHCtSINC.UDEVAT 



Please -supply: 

£17S.CX) 

H.9S 

£2S.95 



Expiry 
date ... 



Name 



...... I«44 44 r 



I 

Address; „... ...... I 

■»*■"■■■■■■ "«■"* H..J1.11 LH 1 1 I I HI ■ L> ■.!.■ ■ +*■ L I J . -■ • L L | 

Pottiode I 

Tel No ' 



"> 



POOLSWIN 

THE ULTIMATE PCOL3 PREDICTION PROGRAM 

C-t*dJCUfifi did. ll Comm t-jrr fjluli wuhltn ir>]<-.-i cM«b4» 
.i>di,iLiii: 12I70D m.ili-hrj PTBt ][l ytart Tit- dn«b*ta updjLrf 
aiiiaTiaaciUv ia letulu cerai tn. 

• MtXDICtl Ne<rutiCCiHi,Ufl>.Wi UUI A'rtAli.llUMto 

■DdMOaOOMa 

4 SUCCrSJnn 511£CxMnmetihilPc'K)teT*UY'i* , r , f *i''toT , i» 

# ADAPTJXU Pi±bitiL[jt£ il tfltOi Mi frVfcl/ bill* h 
chowc 11 mi iv J tfcerwr ti as in neei loi roui iwi. Th» 
PJ<X1« [K<l>:uo«tfortTu2* (Mt be viEtbir Ihrj^r ■■ Vft e«n 

• SIM>lXDHU£imtT MtL>flnh4KlSoatiAKn.immnin 
«p n UwprocTWn. Simptf no* mMi* nfonic* litiRLtn torn »£ aortn. Of h sn fHCOT 
to produie Lsujt ua jtcomiticilv lu« bclcw) 

* ouonrJEnCrJiurt COf**Atati At «iiiK unpi Aipjc inn IBM; arti ntppta » 
en ttp*. wUh i imp) s ifd ruction* br omuwtmwi o dncTrccrodnve sperilson 

(Tth -wuoni renfti •» Hw-tttd m ih«p*c>*ge win* proiK*iiii4ew«*nifw»d*»3T.) 

(.PC Mi SBC B Atm.1 (48E>. ZXBI CMKX DiijoiL Appl; II. BM 1 1 

PRICE £15,00 ;«lluid,usive) 




fiunur. » "ft id^Jii^n 




hmirp Usl inc the oompunr ITDtCQif hit t»jn 

f-.rrjgTan- rr.c il *filh XI Ef-flliih And SDqtl;? 1 
iuBU/ei tut ISH-V'i Sinpiir f^fmin U« (lm», uidlfjefuU timii* :ijti 1 
oer.eTlfpd L'. J^<ti!Hlv l''4lh" i:r.«iriaHi>. uirh PrmlTm-nri' 
POOLSWiNHERwlthriXCEH tli.SO(allinclusi»i:t 
FixDcnalonf t5M 




COURSEWINNERva ?^ 



^tr'j to <i mikrp And tad 

THIPLKTEIISCOMPOTCHPILDCIIJIK ^.SulSSKS^Z^ l».n 

c*Uv BewjDi&ea or Sporunq jiie'. rhn fnm= 1 iij»iwinT in-w* ^jin h* .ijkw >n<i 

.1 ,- j 1 j!»>i 1 rhn f rcqium 11 nipplied Willi* <Wnbu! ihfliding tofl (r liion utd 

iMka<r4 4>i4*!F<?i3nf ilr dr^w f« «JL Intstl C^J^;i**.^F.i , 4 lSl^t|(;n>l H'J-I J 

Ava 1 a«* rrw Ipf^wHMTJ Ce:>r»^:<i u w- ^ ;. Lnaon, ft.-.f.i iter, : A|^ * II 

PRICE SI?, 50 •>!! incluj,™^) 




AVAOAILZ (REIUffif OF PUT) ROM 






phene il Ilts. Si H ' I \\.'.^K1 P jkwMln 

37 COU^fCILLCR LAKE, CHEAELE, CHESHIRE, is 0fil-^=7.a T425 




SPECTRUM 



_S,1j° 



THE MACHINE CODE 
SYSTEM 



" . . one oftte sit too few Jewels of 
SpeC.ruN programriing . . . 
litrifiuea <* ptmx iitvutiy *>WK>il5 
prugntffviitL-'s library ' 

{Simon SpnngtU— Popular 
Coitvjutng Weekly— Jone 1964) 

" . . thf. uih<r4e packsg? in very 

fnenitty and easy to use . . . can £e 

hiqht-j rcCOrVlKn(kd [or those mha 

atejtsl iboui to start programnvng 

in Machine Cone." 

(Phil Holliday— Vaur Cnnputer 

-May 19B3) 

Fu 1 1 y rfim pat i h t*> w i t h 

MICRODR I VES/M ET WO fi K/RS232 

{vMtb Interface l)and tiosI 

Sopular Cent ronirs inter lucres for 
tcJ. printout. 



AfnSTRAD 



THE MACHINE CODE SYSTEM 



* Burtli programs in one piscroge 

* Manv NEW FEATURES 

* Compatible with CASSETTE and 
DISC 

AW I LABLE SHORTLY 

* Send SAL for fully debited Itaflel 

* Available -fom rrahy CO npjlt-M 
■sriopSi of &y HAS I rroil order by 
sending a cheque/RO tor — 

CepiYC. Pieiun-squt. g c<ji f .«:ir» Hill. w«'. vv i: k h#m. K« nt ur:4 B JU 



P 



Hi 

CT 



KtSUUL 
RESCUE 
RESQUE 

RESOUP 



30 YOUfl COM PUT EH, ^ARCl- 1965 



(continued ttoa page 29} 

ill" I 111* -KlflWife 4lTi¥ghlawJV- A* 

Wtttf though, life is not quite mi 
mm ilt, CI'-M was litsi devdoxd on 
i he iwv uliintx « i ma 9 in, discs. 
1-attr the gandard 5.55 It, lloppics 
wer* wed. No* of course, WS hav* 
3.5 in. ind i in. diws. Ohwou'ly )«u 
cannot run arograns froii ihe 
wronji-fizcd dis.es. Bur you alw hue 
to chec* chit til* tsruTjt of thi di&cs 
aic Ltic vane. Thiis an van from 
i ii ... Ji in.- (ij rrm-.-hire, iTcn H li^y all 

na am 

You lOnialJ* b«f, that, is If ad upj 
CP'M Hum u JiiL. As ilic drive 
whirrs, the Operating system pro- 
prjuv is being loaded intc [lie irijiu 
working ntmcry nf ihe mcto, "he 
Ran - random access tommy. 
Bootinc — thrsr for booisirappini~ — 
require* swk very sirnpl; ptogrnu 
alrtjdy in ibe micro io carry itut This 
fir*1 op?ratL<m- It 11 only after CP'M 
die 1" has been loaded rha: it :.in be 
used fcr more complex spcrjitioos. 
ThLv processus it called bu>i* 
strapping by analogy with sameanc 



tull Hip ■■M"' w herself up by ihtir 

CHI} bMI&trapS. 

CL'/M -tig-Jala thai it in mJv in .ac- 
cept your cmntttindk by menu, of ibe 
simple prorrpt i>. 

The a refers lo lac disc drive you 
six rtirrsiiil* using. If you .ave a «- 
itrtid drive ii would be tailed b, and 
so on. 

There it j csnan ibss ol cooi- 
natids thai ji e ill* i.y s available, nod 
can be run immediately. '\ second 
class, celled rnhci g euixlly "crjui- 
vk'nis", haw? to be pul-cd .n trff r;ia 
I'l'i'M nMbtfv disc lo Ram before 
l ley t»n be run. 

One m' (In- most usefil oTlh; first 
dass is DIR Entcn.-iji this command 
pmducei a directory of all (.he files -en 
lie current disc, You can copy fibs 
fana disc (0 disc using copy, which is 
a irunsiau aim mind, : rui ha* en hr 
lijadtd each time yen wish to UK it. 
This cannot, however, be uivd to 
rt»py the CP^M proijrum icielf. Tfcii? 
has in be kxatcd rifhl at the outside 
of j disc : and requires si special com- 
mand SYSfip-N, sittn fir System 
Generator, jnoi ier uuisicii, 



BEGI 




GP'M h mainly iwcd with m croi 
based on Ux Z.SU proceuor. Popular 
niitliiiiL-s which arc ^uili around ihn 
chap include the Siuclair S:>ectrum 
dinJ the MSX niichinK. As yet. 
hnwrvcr, these do atn run under 
OfVM. 

'fhif AmMnid, wheh alsc use* i 
Z-Bt), iuo p^ii l« oi;i;r CFASl when 

itE disc iriva uppcrtn. I : Cf tlhuf 

nucdibes you nortnatly havt to buy 

an adc-on which roui.tin; a Z-BO as i 
second prjeersor i muiin^ ut piiuiLlu 
with t.ie nair chip. This is the iech- 



niquc useti wild the EJJC micro jnd 
lis //-Ml second pmccssor unit. 

As i*cll ii tfiTciinj; CPVAl ILj jjjwh; 
advanced 16- tit machines, Digital 
Restart h .ias also prod Lord sjiis- 
thug falkd Concurrent tlP'M. As 
its nan.e suggests, this albws ycni to 
run several ptocrarns under OJ-vM 
concurently, tha: is at cht time 
liinc. Obvioudy, ytKi effld mjch 

■nun' inr"n-il memory lor ihit id 
hold all th; profirans simul- 
ttrUOUllf. 

Evcfl if it b aulilcdy theetfflct to 
fiber down ia eke cheapesi home 
rnkrob: it is still an exritiig develop- 
men, snd shows lhat there n lift in 
CafYM yet. 



Recording, storing and retrieving program data 



TH- vehv EA.RJ.IEiT comiutin had 

proiritms labariously cnier:d by 
h;irul, macliinc code tit by rtatrtinc 
code bit. The prourmn w»i ilwcd 
simply hy exisiinp, physically ;u :i 

Wm$ of iill-jll [itttj. iti.cJl^d in liulei. 

on i bc-ard 
Later, techiiolo^y pro^res>ed lo 

allow jirtjms of bid lo be bcid nl 

what was called a delay lire which 
did exactly tha-. A Inn* Tube wis fill- 
ed xnt lluid > and crystal osotlstors 
and recciv-'is used to send pulses 
alone I'* Imf.ti. An amplifier could 
U-l- > .( >t-( of Ji^u> llowini; iround 
the mh; for laier use. Unfortunately^ 

when vim swi din I tbut power jff. 

the lnforrxaiKQ was Los. In itiis 
respect, thrse car y storage devices 

*tic ruhoi liht the modem div Rom 
thai dies \phen the micrr. is turned 
taft 

I me slcragt; of programs bcp,an 
witli tlit: punched cards aid tlic;ms 
of paper tape. Series of holes in tbcm 
were read, lint mevraii. tally, ind 
later opiically, to pttxkcc corres- 
pondiiij elrctfi;*! iifii s a bin^iy I 
for a hole, and a. binary for no hole. 
Ultima:ely rm.gn?tic ni^dia Mere 
developed, tha 1 : [dijwcJ much hi.*hc-r 
sr(H,i£e densities and tar swifter 
ictrjcvil times. 

'1'he commoner form of cata 
itou^e found .n home m.croi is the 
audio za«mc tape. IVcgrams are 
simply convened into u series of 
audio s.gnals that can be recorded on- 
to ihe matmet:c (ipe like an* other 
none. A heep if iced io represent a 
Isinuy 1 ji.d the abscotc .if J beep a 
bimry 0. 

^■hen a. program is. loaded Iron -j. 
tape a amilar proctss n>' innslilioi is 

USL-.l LHJ LCHIVtl lljtik" duJlU >1^HUU 

back a series of electrical imputes 
which 'he Ttk'-u can deal win. 

I her; are oovicus rjroblcn.s With 
thi? techmqu.-. Pim, (he audio 
cassette h hu.dly a hij; i-piqciaon 



piece ol cqoipneru I 'my faults tKot 
wond be ur noticca.sk .11 uodit play- 
backs could caue chances in sinclt 
bits hat would * I'nal in u program, 
The ir-c JiuiTi j 3I40 sbw, Ordinary 
<M* rti*- (eccrcki'* p«*t cannot handle 
tcry fisi chin>;e4 between beep and 
nou-bcep, 

t'iiallv, and ill mur ways una) 

inconvenienllyj to fine j particular 
item on a lape you tns.;? have 10 run 
through tieitly nil ni it, Simikry, 
you cannni go b?c< M J particular 
spot wirhoLt r^wiiniiriji trie whtilc 
rape. The Microdrive* fron Sinclair 
Try t^ get rounc this by using 1 cun- 
liniwus loop of taps, ruber like tnt 
tld iape car ridge. 

Ibis type of meduni is caJltd se- 

Huei lijl LvC^JM: ;Du II1UM £S> 

ihroigh 1 he mtjrnunon stared in it 
in sequence Ycu -eannol jump from 
(■nc part to another. T^e lit ic- ty^e 
rie called imicom access, and arc 
both faster aid nencrollv more 
tspoisivc than, iequemial jystcttB. 
The most faiiiliii.- tyjc cf random 

:.l , <•'.!, Mn::ii'r i- l\ rl',. 1'hirh -■:"■ - - 

nam! Jimn rmidom access metnoiv. 
Bui like the deby I nes, it is vular le 

that is, it.- vonLtiU] arc lost ai soon 
*s *ou switch off" the maehire, 
HoKcve*. [St (bppy disc V. also ran- 
dom aecjss., ant, retains its data, 

I'lqppy d ks use th: SUM baiic 
kind of rccoidiij; techiole^y found 
in atdio cataetfes, Imr ihitm eif hav- 
ing a tons thin strip tlty spread t K 
maiinclic amine over iht lurfice of 
} plastic dise. Tha disc ioiaies.ii hi(h 
speed — lypicalLy vm rpm — unckr- 
r < sib the retding and wiiib>£ h«adof 
the qnil TJlis ts Vtry similar o rie 
head of 1 casket :e drck. 

Hi 1 1 lis hl]>h >pce.l o! rotation, and 
the precisioB tooling which allcw t'.ie 
I eat] lo touch Lghrly nc cisc's scr- 
lice me in ;hat ibiur 10 tin~.es as 
i.iuci iolormation can be stored on a 
typical i;im 1 1 is al>o [ossiblu to up 



lEa " »fe^ 







ar.d dowiilouJ pn>nr;ms Iron it vet? 

iijulIi IjMCI 

The disc^ at civked up iltlo Con- 
cern ri: 1 r^cks. and the tr-ncVs inic sec- 
tors. Theie i:i»cks sit; net physkally 
visible di a reenrd, bill ftie dtler- 
minec by the imi-ccm of forniallinii, 

Before using CiSCf, you nornally 
hive to isc a tbriratting prufratn 
",vnch pl^.ct smjll nagnitic m j-ktTi 
ok its surface setting oui the pwbihk 
pftsitioii^ for ihin to be stored, Most 

disci- novjLdj>'.<i 4ie K-li'^^WieiJ iu 
this way, ttmugi a feu a:e hard- 
sectored: they have tma I physical!? 
marks thji divide up the Mirliicc into 
regions. 

M.jij\ dillerctn tmnufacturcn lay 
down the ma-ks on iieir discs in dif- 
fcieiii ways, fan neujis thai 
sVhoi (>h - h^ micm rfluld thrr.r<- ti .1- 
iy run a program wri.len in say 
Basic, it might not he able to rr.id 
fr-nm ihe disc txcuix the formab are 
differ nil. Another fictoi to be con- 
sidered in this area of compatibility U 
w.ielher a div is mi^le or double Md- 
ec, ard what ihr uessit) is. 

"ITiesc cfe the new J. 5m. floppies. 
Celer versiens were -».21in. and 
before ihu even M*. Even Ui-mt-b 
the physieal tiZG bits cotK dawn thU 



dranai.calJy, capacities fitr floppies 
see well up into the Megabyte 
region. 

There is a nr.ore espensive version 
of Jlopnics chat is jus: bcginim"! to 
filter down to th: hsnie computrr 
mtukct This is the hart disc. 
Whereis lloppie: allow you to 
remove arid replace lie disc jyatein, 

Wh~eh invosiis rh-ir [hi u>tuiiie d.ru.gn 
muil be I hat much more robuil, hard 
di«c ^yiteths ate complcle y enclosed 
in aimgliL coniairiers. far higher 
rot.MftB xpetdii can be emnloj-ed, 
allowing Easter icce» and much 
higier deasiiies, Hard ciscs — or 
Winchtsrera at they ire sotaetimes 
known — caii sto-e UK! Mciabyics 
god over. 
Looking into ihe future, th:rc s a 

ri>rhnnlngy jiht tn»nipniivi fn crinf 
through which, prnmiies eve.i mure 
fan'iisric stijra^c capacities than those 
of hard disci. This is trie lij/livwl Ji^. 
Tiny pits are burnr into a plauic 
disc by n laser bean, 'This same beam 
cun be used to read than. 1 pr reprc- 
sen's ,i hiTury I. and the ubseaCc «f a 
pit -i 0. Sysleias Ifeivc been designed 
ihar can srire about 1 Gigabyte of 
dan - iha: is lOOO Megajytcs — on 
3 Ihn. disc. 



YOUF COMPUTER, MARCH 19$5 31 



THOUGHTS & CROSSES 

37 MARKET STREET, HECKMONDWIKE, WEST YORKS 

Telephone 0924-402337 
Access Visa order 0924-409753 



ALL PRICES IMC.UDE -/A' AND DELIVERY 




■ n ■■■ 

ill ■■■ 



II 5 
■r*m 

: ::: 

n -i- 
tltt 



B »* J\->' »4> us 

.1 mi m* «• is 

an \im£Z 

■.-■Ml ' a -"W". UWT 



ill;- mui 



Ira 







KB 



-k' flit '-"-.- 



■•::■ 



WbiPrTrl -i 

uu •: »- i- 



SS :s 



II IF 

1 !■-■ 

■•* w 

1 <!■> 

UPV 


Wj 
r-Jai 

IBM 


/vi ■: n» 

41 ntJWli ZM 

M 
E--v« ■s.-ii'T* 

IkH *i 






r» nr 


—J! 




L'MW 


■ p-i;pi? iiiji 


[IK 

ii >■ 




Ian M-aa. a-a-.*?, 




,1 -a;.. 1 a- _..■ . 




?*Mh 










WJk 


. ■ ->.*-•. 4iiic- -n 


i -4 ■ 





:-:■:■: 
..... _.. 



WMPH 

V. J. . > .1 






r.-act 

! "I & 



MaL*p 



IHT-1 al* - '"'■ 

: ■ :■: "i >■ >. 



.mw.... 



^JJ.fari.ripv.rtJ 



„£ ■?: 



■*■■."> L"iOTI." ■■■%- 
4 1 N*+l Ha MalM ji a 



it..,. . 

■y fi * I ■— 
ru;,>.rn.-i' .4 



li-ll«l'Iil'<* 



SI 






■nil it**«^>p 




MA 
ipti 

■ 

Hi 

1 1™ 
if* 

HI < 



1 -- - - 



Hflri Ik-pa*- '■t.'r.l'V 






■IB 

■in it 






IHK' 

r ri'h- 

i 1 " >■ 

OB 

H-IW 



CAw 



....-dr.. 



■-■■«■ -S^ 

4-.*,- i*i, 

■a-arar-ar T 4hn 



E* 



■:>n 



P"P" "1-PP u*.# 



•;-'■ 






■ ■■ 

I Titan 

tm 

ilii 

; ;: 



IE" 

IL.B 

n*r. 



> UK,-.!-. - 

. ..- . 
j-..- h. 

frlllla.' Ma"lffT 

">■•>! II IV44 

In i!Di||f! 
p..| Li ii| LrVl-l 

'iHfii ih 

V* Ha x Mi 

■H"4"j ■h-pi 
P*prt«H ?■■«■ 

rhr^ lY'ti 
I .* Ilia i. 

U¥iri-"i 
. .. _.. . 



■|- - . 



AS hiii 



a. lab* la tip 
AiaHiklf- 
■trim 



Pka-tK-1 
MHMi 
T -Hx ^y»i 

■ «■- !■■ 

■'»■.- 



«... 

iiaiF 
-■■.,^.1 
lui'f I 



?: 



rHH- 



*^*»*J 



V4-lilpHl4 Pi P.- ■"!.■ 

'■■ Jixl« , ±M4fei 
j,... i .. , 

^irt'rw IV s Via* 



ii'rtjTn".',,".' . 

k'aaji l V l>,l A,l-hH14i 
■*>«tjP 1-ilrH V'i.#>t>f 
tirp-a*t frrvi 
i- .-I . r >-i i. ■ 



"— Yir'T'iri 



rr Hd.aiai 

Ha^F/ll-lk 

*yi*mH>i,ii b-Ma- -Mill 

INKjIH ■**,!» t™^fca 



B 

■ -, -■ 

*IK1 IV<I 
IiilH Ihpi^rv 

■ ■-LI-' ',*■'"»' 

:V, — 

i". 
-..■>.. I. 
I.,. 

CMrak 

■ I' 

i*-haW' u m 

;;?::::: 

I .■ '..I .... 

■ ■ Mi^ur 

r. r.... 

■ I •..!»,, 

51^ 

■. r . . , 



r ii 
i.ff. 
!H' 
;»« 
mt 
lift 
■^ •■ 
rq« 
rii- 

IP T. 

On 
isi- 

ITT 

ipn 

fPB'. 

rp ii 
CPU 

rp;' 
ir. ■■ 

HI' 

a* 

E* -," 

liv 
IPtl 
r^ I' 

rr. =' 

HI 

nn 
|il« 
, .. ; , 
4pir 
(TM 
£*!■ 
'h " 
■ . i- 
-'■=■ 

rp4. 
iiy 

tr*i 

ClLU 



' M 

rin 

na 
fPID 

;r > 
^p'n 
ri'Q 
rim 
IP'P 

i*a 
capa 



I.,!'...... 

■ttl 

-■■^■4 nirt-i 
WiTnj 

P l^iMI P 



rpir. 

■ ... 

■ i-. 
fin 
iiah 
IkH 

m 

flPR 

MM 
Hi* 

' :■ 

rpjn 
pua 

UJfe 

■ ■ - 
■i ... 
rp«" 
can 

It** 

' i- 

F ,T. 

m 

»n 

rut 

IP7P 
H 'I 
l ■ ■ I 

i>P- El It 



■Wit*d 

»-*.rtrrp 
' -'■ •■ir'-rl 

SB? 

r-a-fcra 



"<"■ Ip- 
I aa H ltop aitft ' 
fM .'.,, ClaW 

I'a^aar- faavriH 

'p*b-/*^"'" W.a||, 
rVF«*»a" UMl-J 
1-41 ¥ T**0 
tlff«-f-*t| rtar^aFfepi 

1'lt.l'J 

l'*d Vi(# Uap-iM 

LThI *! h 
cm %i-Hw#i 
f V *-r'* 1 , 

kkp" Lurtaa 
Lp- 

klkla !■ a ■. 






«■'■ 



"•-■". 



h v 

rri- 
IT 

[!a 

fn- 

<m 
I'h* 
n« 

■'. J- 

lp ■ 

!l»fl 

n« 

T 1- 

tit: 

nv 

Elf 

I. - 

€■« 
II H 

• 

■a- 

rr.tt 
ft* 
tin 

CMI 

:t2 

tlH 

n« 
ii n 

ti 

■■•:: 

m 



ii 



• • .■■, 

rrr. 

tm 

■■ 
1 1 ■* 

H i, 

IMl 

'::;; 

- ir. 

HHI 

L'flP 

m 

nr.r. 

MS 

■r.ri 

rp» 

fin 
'(■Hi 



- ir. 

7 ir. 

'!«P 
ik Ji 

-n t 

rtft- 
(I rt 

J* ?p 

-■ <p 

» I la 

f M 

|l|« 

ftil 

. < -.,. 

an 



rWijal, l>-wKp|l-y P« 
M Slflf r'.a'r-.a 

■ raM 

^rTm»# a'"!r'a*«J 
r-.i ■■—. 

SI ■> - i 
la>H> taaa* 

i~ h| P J 

pNbkO r 

' i -■ ■ 

■UfM.d.1 
aajw4« 
.11111 -Tr J iMl 

ISd* 

aJ-rS- 

iHp Hha ■■ 

'* ■■■'—■ • a P.ll 
IfP. 

Sr *** 

^■■■iJp ari hplF 1 
laW 

M-j>hp 



pSr-f-m 



■ .1 ■ ■•-*■- 
Lmifp T.ili A 
VrtrfV- T-il i A 
TNEklPlMM 

■■■'-" 



' '* >F*« 

1 FHaW lar LM-1 



Mini .".il 

I . H J .. ■ "L..I , 

I "...aaM "it -Ii' 
iJlalllll Lhal -¥rr ^Pf 



re pvr mil 

\AHi Hiv.- 




I -a.- r 

I- -"Pf ■■ 

hafM 

baHa«HI 

I*rpi1-v- 

k! aa .... 
tflfUaj-! -■-— 



P.P-. 

■.Mr-th 

... ..■ . 

'■IF ■ 

LlfaM 

IhlrV V 
I Mr- H 



I -/ r- 



!P1« 

nxt 

■ nri 
iPli 

4*1* 

;is 

ir. Ml 
17 HI 

taai 

rub 
rp is 

LPrt 
{'til 

I7"j 
rr.qr; 

ipin 

1 1 PIP 

LVlk 

il«P 
JPfb 
'iih 

riip 

I 1 ** 

■ 

■. !'. 

IMP 
<l H| 
JTPIl 
' IP 
Jl.i^ 
■ i*i-n 
I ,-! ,:i 
IP'I 
fbiQ 

:hi 

■ h.-^i 

|P*U 

■ '-V. 

■■ :;ti 

tt-ta 

■ ■ ■,:• 



I 'I.I 

II... 
upr 
■ i'pr 
IMP 



MAP 
fill 

'•" 
r ir. 
I .". 
■ p 
!b .'* 

ft.*! 



■ I 111. 

ii 'p 
ii ■> 

■ ... 
-■.ii. 

ii;^^ 

ll)H 
. rl 
» It 
MJI 
ilfl 
" II 
' ir 
:! II 

ftg 

-Int 

■ it 

ri.ii 
rrlK 

Trlno 
i is 

LP.lt* 

;i pi 
< . 

fl»l 

:'.*! 

'HKt 

'P! 

.mi 

i yi 
i pi 

■■'*.< 
A.fi 



•^ l i*'i '■. pi< 



■-.-. w I- ll .- 

*.H4-#», 

>>j* 1 -pj-rflap. 

r'tfiii^ 

r ISH '-*■+ TphIvjtHI 
r»fll|.|'l-r ■. 



LltT-t— 



■«■-■ n w-1 

-■■'■■ 

L^hrr Inn 



ii kk 

Et n 

[IV! 

■ i pjj. 
i > ni 
rt it. 

ii pi 

i ■ '■■ 



14 1 1 

lc rl 



r* rr 
cm 

L-'1i 



|lwj^n>rnipr 
r\l~.« .- I-._i1.j1 



hh -r ph. 

Htw " - ■ -4 

i ■»' i ■ 

1 1*1. hPfrMi Mil I 

*■!:» rap, 

lanHilh! 



■ -.-■ Mill.. 
'.»!.- ■ .'.l"l 

FMlkitM 



I, p., 

MlMi 

'; i». 
filKi 



■' - ill* 
rtffi ■ ' 4" 

rt «. rt it 

ill) 
[IIS 
HJf 

ii is rtH 
it rt ii rs 

liti p 



rt-w 
Ck ■> 



i.-i- ■"-t*jT4j 

AuHfta 

I r* »*-iny 

Up.. I".-.- 

V!l I- 'I All ItVI 
I *»1 *,*■* 

fMlafV 

ipp-- :■ 

tllMtii If 
111" I 

OW-h h *■-♦;-** 

BM« V -, r- t---il.i 

W4MH^ J- 

Tm !rir** I* - lli I atiral 



MtfIL 



■-,■>. a 


ii.i i 


in :■: 


iti. 


IP PL 


& 




. 


rip fe 


i j n. 


fc-*topr-» 
a -hill T 


i.-ii 


11 H 


if It 

M 


i ■>; 


&HH4j-# 

T.:i-p--p 


OH 
47 " 


W 1 !*! IrtHl 


nit 


r. -■ 


twrraP^-^rtHi 

J.il-'i'.rl* '!l Pll, 


*.i ll 


i- ■■ 


V=tr*aF^i "^1 p:ii 


I-::- 

41 IL 




jprPPrraaPBi ^rp^pjrPT 


lp pi 


lira 


■ . 




'?:-: 


UK 


!■»-*• 


if 


+tt* 


!J«r 


:-- 


lik-H 


I ii.is 




1-1":. 


<fl( 


1-r Ii 


!>* 


11 11 


-p. in 


!?*■ 


Ilii 


•n ?i 


rw 


11.11 


■a n 


PPn 


J!« 


I,pT 


Ii. ».i» 


1- ■• 


1* h- 


LP»*.i" 


lire 


«K 


LVM 


ll.Tf 


i*- r-; 


aaaaai 


tij.ii 


iv :■■ 



t!itt MB 

n i tr. hi r. 



II.;.. , i, 


on 


in 


Ll?lt-pp4ih 


titu 


DM 


\r*T i rrrH 


LlJt'l 


■ 31 


iHtf Pti 

WH-U-4HI 
Ii- - an 


rlPI 


.1 41 

is; 


idr 1 


Itw 


'H 


n*i 


«11 


WaW »|l 
^■rPll l''H l*fc.4- 


:■:::■ 

rUM 


r ia w 








MMMtt-H pH> jH 


L««l 


.in 




1 itll 




Urf«-^-p i«,ii 


.' .>pi 


t'l tc 


Wl-l|-rJ-Hk liaikk 


ttal 


in 


M !>*'■■' I- "1 htflll 


K II 


«« 


UaIk.Jl. ii III.. li 


LI PI 


,1U 


MJ Ml J It, p. 


i*"*! 


WirMf-p l»,ka 


1 V 


ni- 


I'Haj.i 


Hil 


IH 


W- -H- 


LPJSI 


■ --. 


y B .a*aja 


IIPI 


hJi 


U- ■ a U . 


fpli 


Hi 



HE pfcjt 



uhmiMi.. 

UMP1M 
V.H4 3lH 



". ,i,i 

U. ..,!,, . 

Bi 
i.. 



, -I. 
■Jj"t 

TltPl- 

IS 

rt-» 

..... 

MPS 
(»*! 

IKII 
C*ui. 

rin 
rtjtp 
...._ 

17H 
('« 
Zvvj 
r'.p' 
... i. 
till 
tlSI 
llll 

:..: 

i-.p: 

UK- 

I - ... 
!"■ 

HP! 

I -J II 

I .;.. 

■tpl 
n*t 
!-:■■ 
till 


K-U- 

I ,..- 
, ■■■ 
I"» 
If...' 
I'll 
1411 
11,1.: 

ill' 

«*:■ 

Hil 
■ jn 

i ... 



■ ■I 

VIII 

i It lit 

!: 

ite 

,.. 

Mil 
r4.PI 

n it 



*,.... ... 

Sat 

V aapat- 

i aii pa, i. i>i.,(.v 
Vt-i- i ,..w... 

in-¥f*#-pI*. 

rVlAl bia-^.k-J 
. ..... ; . ..a 

ir p-.nr.i-i i 

. Fl ,.,.*. 
lb 1 i-i rw- 

«■■ 'pJ-4-' 
^Hl l»"mr»i 
■■ , ■■» - 
P*PP*# 

■a»-L't a-pl 

^■fii'nl'H 

i 'at. '..... 
'. — a I,, i ... 



►W W IaMrl 

^■rl ' rlip.-4»- 



2t 
41 
;«->i»« 

- i.i. 
i.i ■-«- 

1,1 kkaVl 

iiiftifci 

I.. ..La 

JI .«:'■■*■■ 

hr Mi 

(hiHilti 

,. t I.i. 



ens 

■-!!*■ 

-lT.HUl-14.-' 
Pr.'4-l lEn.KtP>l 

. '-mHl 4HH*1 

a. i#4ri -*W|4HH 

Pll4PP^"l*»»l 



•■tit hn 

Sit **« 



III 

111 

ill 



'C 



^W^| ^l >WT^y^ 

■fpal-lpri .-4T44H-. J 
llMt-hi-^ - ^ 

! 1/ " 

Liu. H.t^l r «■#+-- 

inixvi *S» 

tta-a l*.**Wflar 
tn/tf ||M'<IUU 
I - .i 1 1 4 1 %+ llHH-1 
ll^l 'u .<ala • 

Lftwr 



hi i tntr 

" - I- 



I '.H ...-. _J| 

MH 

a., .r 

"a+ i* 

4*1 (U 

... a< 

.'■fV 
PM1V 

-I II 

::: :: 

.pi -. 

Vfi* 



.. 

rt , J . 
1.14 



s,« ;; 



in « 



.PI .- 

ififi 

"I! '.'. 

... .. 



V. .. ■..!.. .1. .. 

Pld-4H Ll DMari iti ■■ 

^ — t-*^*+ 

*L. P |4.. ... ,. 

-.'.. ■!-; ■ .... -. 

- ■■ '■"■ '■■!" -■ »- 

fcl Hi Jl H r |t|. ... a- 

Ht» Tr* Clrtp+1 IN4PF 

H*M It* IW I IlMW 

"rllKfcl lb. mi 



■■ 3". 
1*1* 

r . 

i§ 

■ r. U 

r T-. 

I* « 

".J 1*1 

IL* »* 

Sit 

|-*ta 

::;:: 

.4 .-. 

i En 
iVtp 

lh in 

lIK 

tin 
«** 

ft s;; 
ip i-. 
mi 

4b to 

II HI 

!H .4" 

III 1.1 

tin 
lit. 

Is 

II *E 

ii n 

El IL 

LPPP 

n 

1 1 M 

ilrt 

ml- 

la 

n pt- 

ri>» 
Ll.Kt 

L(,n 

Sfi 

r-ii 

ii,pp 
Lt It- 
I I IrK 

nil. 
. >.. 
. .■ 



■ I p| 

ill! 



1 ■ ■ 

■ n 

till 

"Ii 

41 11, 

tm 

44 p. 

CI .14 

Hi 

r*« 
till 

era 

Lilt 

41 .1 



tan 
<tip 

4*?P 
I'-.-. 

p 

;r.r-. 

Till 

|| 

■CL-. 
1P)1 

aa 

IL'I 

....» 
ill. 
|H', 
HH 
H HI 
4 4PO 

■ - tr 
I'M 
L-W 
ll-i' 
14 'l' 
l . . 
I -. - ■. 
IIh, 
11*1 
i : i p 
I'll 
4"' It 
FM1 
H»t 
11,'t 
ir.-. 

T1J.P 

hh 

i -.■ 

LM| 

MM 

rlAI 

l*Vt 

i *yi 

■ la' 

i im 



■. ■. • -p' - 

frtWiiA-i 



■ ■■ ■ -t *■■'.>. 

S.«..*i^*r 

jVMaHr- 

*Ml 11 r . 
i . | I r • 



(mff H-a-iH 
+ttV 



... |l-Hl . 

r.i i 



■ ■ •!■ Mi-Pl*" 

^i*f*r+h-- 1 V»a*' 

7-.-. .- t* ,-..i-w, h .m 
■a'jiafcr -f f'J~ 

Pi-n- n {ia.-* 

■ I- A. 
Mrtlf ^ 

Hitlpi **j-^i|- 1**-- 

drtPf^I ■arrfflrTrrV' M 

l-bT4*.i- fM 


"4..L.-. 
^-.PP*^ lJI.pl 
■„.. 
L.k hPSj.l 

«tp, 
,.. , 
» "■ 

i5Vi.TJt.pip 

P.|ri4.VM4UJHSp 

Q.|P41UlhHP 

14., - ' . . 

tll.i"" fi**". 
1ip44.1i.r4. 



LPL.I 

Ltjaa. 

VI pi .jl- -I. 

Vk.i i^r-r* 



4.1* 
llll 
trTtt 
if It 
till 

411) 
rp. rt 
l>l> 
(l.tl 

ll 
HjB 
It H 



I*- p-i 

!-(■■ 

•rt it 

■TT I* 

I-. ■ ■ 
*> H 

IV K 



H H. 1* n 



11*-* 

. , ... 

PWafcfM 
Att*rt-- 

, .T 



Mi * aA. 



ittif 



Sta>M( 



aa it:; 

nit, mi 

['» 4-Flt 

iHa iv-(*j 



r«*t 
nit 
. - M, 



ttft 



I" 

r«Jr 
riikk 



i.at 

S2 



- * «M 

Mm 

u. -P..,. 

«W.iWv 
r,ln-r|.--i<- 

A1|p*> Slrafcll 

Apun4.ki 

- t ■ - 

J.a..k. 

m*^ 

Li." ... 

*>arar -. M |fi 

.1... 

^■IWfM 
Ifn-lrtlhrriilM 
^htlPrl ? l ikk 
^pUilal V* ilk 



..4k. 1 
'■4... 

i-» . 

p ■. i 

p^-a 

*»1 

::■:; 

4L>4r4k 
*.1^» 



P>ll..k = - 

PirP...,. • 

Ppd.«..j 
h44p**t4P. 1 
AlWI*.P'4, 
*"pk, 

'4-i 



|l« 
.7. t| 
4T kp 

IT It 
17 11 
17 II 

rt.K 

IP St 

( 4| « 

I. '" 
I *PL 

41 4* 



«W4 

PiPr, - 



llll 

|SJ»t 

. ? .. 

1 in 
I4H 

4;>t 



iw4 


14 H 


WW 


p»v.a 


111. 


11 ,n 


b-.l+.p H.i 


41 .4 




!.. 1 . 1. . 


14 rt 


41 rt 


P-lPl Prt 


14 14 


l» -* 


'.. 1.. i. . 


41 K 

4d k. 

}*■> 






rial 


,r. -. 


IM*. *.l 


Kb: 


ir. n- 


Krtl:, 


tut 


U.S. 
1. J... 
'k 1.. 


:... |.i. 


<tn- 


!Hp. 


ffj« 


:■';, 



Rbi-iqb of pograms avsitable for MTX, BBC. Etectror, and Amstrad 

PlfRS*? mdBfStJWpTiia -.Ii Projjramii rAqi.lroti,: (2! ComcutOr; <3) Amoun: encloeed; (41 Mamo St Addrocc. 

All prices jncluctek Datking i&'VAT. Ovorssas r-jrders .v^lcorfle. 



32 YOUR COMPUTER, MARCH 1 Lte5 



If you have 
anything of 
interest to tetl us 
about your 
computer club 
why not contact 
us nn 
01-661 3144. 

Local 
news 

GrOningen 

T'te lewl Hounded Swiss 
Sine air Uaar Club seeks 
rnerroers. "hey are keen to 
establish links with similar 
ciubs in Germany and 
Austria, MEin anguage of 
ttie club, apart from Basic, 
looks lihfl German, but 
since it 's Switzerland, a I 
you French, Italian aid 
Hsrrignech epeokers should 
write lo Sinclair User Club 
Schweiz, Post ; ach IS, 
CH-B627 GuJrtJngen. Tel: 01 
241 '9 C0 cr 01 940 00 25. 

Blackburn 

B aclcburn Cpnputor Club 

meats on aitemata 
Mondays al ths FarniUfil 
tiJlul. Ballon Road, 
Blackburn, al 1,20 in the 
evening. AH machines 
welcome. Membership is 
about £5 for adults and £3 
for Ji.nio.rs. For more dnlailK 
contact John Schofisld on 
0254 28" 27. 

Lincoln 

Lincoln UomputerClub Is 
part of Lincolnshi'e Micro- 
processor SoceW and has 
some interesting evenings 
billee fo' ihe future 
inslnrting "Music and 
Computers" and s visit to 
the Computer Cortroi Unit 
ot the Not Wear Dink. Tire 
clib Tieels at Ihe 
Cardinals Hal, 263 High 
Sireet, UncDin More 
details iron Doug as 
Griffiths 659 Newark Road, 
Svaltowbeck, Lincoln LN6 
85 A, Telephone: 0522 
6B0578. 



Colwyn 

Coiwyn Computer Club 
msets al thu Gietaia Hotel, 
Coiwyn Bay, Contact 
DBe*an, do Aoergete Road, 
ColWjm Bay. (J wyd U_29 
/PA. 



COMPUTER 



Paul Bond discovers one 
of the great grandaddies 
of computer ciubs with 
modern ideas in Harrow. 

THE Hakkisw rjOMRJTHt Uruup 
hum study be mk of the peM urm- 
daduta if i Jit :'r,i!tfMi;il prOf^aOttUng 
pbrromcrwsi. I wmi dairii to ruvt 
■rfjriil im-eimi: ■nfomiiiih- in Jab l%8 
— >ex, IWfl - mi wsfc li.vmatly 

continued in. early .VW?, .Seme or gur 
)Ourgcr readers muv marine- thai tin.- 

W^prat prc'riiMT. lilt nrij,i[ijl membtjh 
tiinl to content With W<f dodpiu; 
pteiodacryls on the *ay b*ci hi me — 
l-m ihe pkirtirri-u; t-onu cmipiicroi' 
mis -iine w* ihr N»corn 1. 

"Machines win in £o in ph.i>cj 
htr^," opined nut ciub uitaiit^r. 
1 1-irst there h\li> ihe SiJECorr, ihsn the 
Commodore 1*171'. then th.' BRC I 
dcw'i know wlm'll be nut: 1 '. Many 
naior uirnpuier industry figure 
i must mrliiiiiT vluin; thii Jii.'fr 
GttOlty. 

Wednodoj? nighi - or n (en i is 

.iicnutc Wtiuwduy ni^lil — Li fotOI 

mphi 4i Ha- row, ai least in ihtwty. 
bazyle Butelier, >L-ll-5.i*led BC-dMJT- 
muDot t.ie dub, hjil briugJu afc>n>; a 
nrouiypr mule-ud devLcthat he w;is 
vorkinR aOi Hid on previous ennJiut 
vinous types *i' PObobl bad brtfi 
known lo nuke 4ii appeit.ii. 

Ml Hi ichrf *;n if pMM te poim 

out ihui while It liimsdf is ,i mkro- 
iajvc en?,HKfr, tncmbcrshiji trt" cbc 

v" ub !:■ drnviil fumi all v, j [fc> 14" lik. 1 

this w* c:ilanly I'lidtn: 00 (kt 

ni^Hr. VifWir Gtoptctr arttndiid (hi" 

Chib. One nxmb.-r, j iimsh I l-.clou 




nurmKcr, had acq jj tiii j JBC ro Liur i 
BuW Ochcr mamlvrs pn<1ud:J y 

t-criilmuin win worked for i buiklL-r's 
Cmu i*jci muini lined ibiii it- iiscdir lor 

running :he tui ipwty prff t"kb, a 

iiLcuiler .il" Lhc McinijMtjtiin police 
I'firce, and -a \-.niy who disjjLycd s it'll 3 
remarhable i.'luc'.stncc m reveal her 
none or eccLpauon o the p e>* uisi 
>ln- rausi be avuni.-d ki vorl, t'tr 
sialic iccrct iltfpjirtruciii <sf jj<i*'crr> 
mL*nt. Oi:e voulj tiivc thought w: 

S-nrre of the younger mccitiK's ul 
ih: club were ^nn;^td in a ptnu 
rmuknJ "UMX on (Ik. Vlo«n" r lm 

ci rJdbm ul' james roFtvarc fot rh: 

HJU: iiiikhin* wii i»i ]«irdirn.d — 

certttfc oonpnlo, iuk AwtiwtrvSblti 

wire, boivr^rr, wen ct'Hi,!tlttoi I* 
hint produced MifiK^u^ibty rti.UTi.il. 
Kit cm flub lecture hate kctuiiol a 
tak on :i-l.-wn waic by Bcb Tidy and 
i dist;u,»tyn of C*mttwdere prtv 
ii,niriri'iiti|! brjdxmquM l«l by Peie- 
Calvcj ol Supenoft, Dtubilnii Wt 

Mill -il I r i •: ttiOililssi . t'l ilr- :'(-. I 

gt>uf), who cuiierrly iflrtl Hi i 
niniii>-r \ hcisc. The Kir row Conv 
ijuei 3rutp nas plari fir n stard ai 

usjjI at ibe ! jndin Fesin-al yf Cain- 

pLtnig(o bv Ji^ld jVpnJ y-2T . lri]drlei 
Lib.iLi; [hi: Its ival should bt* di[tL.tal 



Apart froir. leCiutct. hirdwale 
eveninps, ind artsiidint'c M exhibi- 
iion», ihe club operates * niaiiuui*' 
lihiarv Ihiv coruairK Brnish cnid 
An er«an Tiagjeiocs, echnicii bcok> 
Am. tftO ^ hu«ts>X modem. 

The Hdirnw Ctitipuitf Group ih ,i 
member of [he AsAiciition Df Loniim 
("Uimptter CIujs — Bsjjylc Bttchtr is 
an es-ireasurci of the ACCC - as 
well k Iktiixe affiiia»pH m the 
Aitociiucn wf Cuopuicr <Hub> 
n jc.onal gnup 

MfEnbcfkhip al Llictliib itsflcialillca 

vol to visit Cwydon Micro Club, rite 
IniMTierKleBi Conunodorv Products. 
l.\ei Oiuup cliitx^ Sutrnn l.lbiary 
Cluh. North Kcni Anairur 
Conputer TAnb — and thw is So naaic 
but a Sw. 

KCG nuels *\ 7.30 pm on V/kIucs- 
davi m ilic Keiion Ko»it ai the 
Uamw :Vt^ Centre, opposite The 
Alum Public Hiuse m Hartow 
Wi-ilii MinnbfrTlvp ii £5 pvry*w or 
yipuui viiii ler Sdp a nnp.-iiiiji. LlttC 
uM[.- ?tws«Jd ronlact E I.oridy on 
C1-»0V 7410, PETE u-'.'-^ iluvM eon- 
tact P Buissn nn 01 -9t'7 5^-j 

Far iiroiiniiiii>ii aboai run: r/^oup 
mcauipfi telephone K Merlon on 
01-201 9137 or A Llison on 0I-W1 
2553. Club Sectttairy b Norman 
Qinpb-.'ll, reacialile on 01-SftJ 12*1 




YOUR COMPUTER. MARCH 1995 33 



ss0# 



BBC MICRO 

- USER SUPPORT - 



10 ISSUES OF BEEBUG MAGAZINE MAILED FREE TO MEMBERS* 30 
EXOTLNG GAMES AND VISUAL PROGRAMS * 43 SOFTWARE REVIEWS • 33 
HARDWARE REVIEWS • 16 BOOK REVIEWS » 150 HINTS AND TIPS • 25 
APPLICATION PROGRAMS * SERIES OF ARTICLES FOR BEGINNERS • MANY 
ADVANCED TECHNICAL ARTICLES • NEWS AND PRODUCT INFORMATION 
• PLUS SPECIAL OFFERS # BIG DISCOUNTS ON A WIDE RANGE OF 
PRODUCTS • EVENTS • BRAIN TEASERS • LOCAL CLUBS • FULL 

MAGAZINE INDEX 

A YEARS SUBSCRIPTION WOULD HAVE BOUGHT YOU ALL THIS 

figures based on the W issues c( BEEBUG Volume 2 

BUT ITS NOT TOO LATE TO JOIN FOR VOLUME THREE 

BEEBUG PUBLICATIONS LTD. PO BOX. 109, HIGH WYCOMBE. BUCKS 
PLEASE EtBOL ME FOR VOLUME S of BEEBUG AT £11 .M (10 ISSUES) BEEBUG HAS BEEN ESTABLISHED 

name FOR TWO YEARS ANDNOWHAS 

' OVER 25,000 MEMBERS. IT OFFERS 
ADDRESS - TOTAL USER SUPPORT TO ALL BBC 

AMOIINT ENCLOSED ..... . MICRO USERS. 



PLEASE MAKE CHEQUES MADE FAY ABLE TO BEEBUG PUBLICATIONS LTD 
ANDSENDTO.- DEPT4 PO BOX 1CS, tflUH WYCOMBE, BUC5S. 
WSTRIBUT1QN A GENTS FOR BEEBUG) 



_J 



Self Adhesive 
Cassette & Disk Labels 

it 2-* HOUR SERVICE FROM STOCK 

if AVAILABLE WHITE OR TINTED 

if « HOUR SERVICE ON PRINTED LABELS 



CASSLTU LABELS ON MSHEfT& . WTUA Oit*. wUt*» to v>Mlut,* nnninj, „ 
HWCHftlng 1GB hlwh OWL 200 E8W SO IBS, 508 • E12.BC, HMD ■ Cl « 



CASWm i-*nn.} IN BOill • Cimt^U wd* Int.lnr ind bactftg MP* lor 

(.nniing b> c.ot*pvto piinlf - «w»*rt»* *1"H M f "led Hut pirn, ^tfi. X#t|t. pay 

WMITs. BOJ.CTififi.lPDO fJCro.HSO Q1« 
TINTeD; 6(0 ■ Eifi.90, lDOO . E7» 15.2009" EX. 95 



DISK LABELS AvaLatHin 1*7 6 S6 l*w wicih 1a rnrviinTorul fl»py 4l|t I36f<-i dwpl. 
ST 71 X HJn.ni for [hi MSX »T\H * emo»:l Fluguy dnk.. TNn* lnn.li ill (II in 1-ldcv 'inri 
hacknp pep*' with i wi[t Btwuit icomi. 

WHITl. S6nm; SCO ■ : 13.75 10K)-C17.7f, 200D CO 66 
TNTE>.«tvti:5»-£15» lM»-Q<H&..iOJn (S»a* 
WHIT* TTTiintA C<mpicld<* h« fWM 1«H 03 OS SXM HS?C 
TNTEXI^mmlrCwinpKtdttkrEdO Ct » 1 (TO ■ £3106, 1000 - E< » 



Al Friers irwrtirl* V A" and postige/ packing 

Encellent discount* lor iaige quantities 

Please send sump top pmlirg price lists and f ample labels 



jlmoGoDsQirian. 

Sail Adhesive Computer Labels - 



LOTA4 

EMEEE DEAN CENTRE 

CUf OLIUK IttQUStaiAL EST* I % 

511 IIM(jBJU"Mt 

<ENrMEIOflN 

^tfjg^ww was; -a&j.'i 



^S^oSfj^, 





SOFTWARE 
FOR 

LIFE! 



Naw jold Star I'fe eientborsriie q! 

i ne ball ware Library is your key la a /*si 

l r ssiufB trow <r tapes costing up to El 8 each. Thoy 

are your) whonovo' you want them , thrM at a time. .. and 

a full week's rental won I etei mil fun u penny in Mini fr»u;. ! 

Only thn wl|JIM toKwarn kurjir, 1 n:«. inn rtnuurcirj b mike jucr an amajlnfl 
ollll'— |iW sullworc ur I lu! Out Ian mtflabyto camptle.' fln9u r es fasl service; 
mir iiii.Hfaiivi rm-rtrtll** rFtitkvju* mihn V Iuf I* fha*tc krem »u« fit t(tp 
firxade pamet. 1I4 AdvCOlufCJ. linultlicni andolkEf camn, and Qiet 120 {reai 
[.pnli iim tnd Mtriiin *pp1 Calling- B&% *r» Iff |ht SfWtaim, lltif (til dntdwtl 
WnwflOO Conimodorc 6* iwiO Z X81 . Mww rotrascs are cumlaittly b*in( actlei}. 

Jain.^0 <h"» rnnn-y-nvlnn K^«m+ thould <<»*t f<m E£4, as hi lollDLUtAu j vtt*t , 

vpucar* i-Oi-n 1f1iS rwnin it ruit pika— £12. Ffon- ihfn d*. v<u (an «ti0 iwOj 
:hr«i1ar*£fforn :-u r 5 hop *non (> vH ym * un ; rr ! r vou <rd w Uy posl . all «v ajK if 

:<liti psiFLti'fuirt. inr, p^f lajw TFu rWiliil is utf 1<rellv fiao- in ailNef CUM, 
VVriit'i ncre. ynu car HI your lU'plut iOllwarc ioolhfr mamtHf* (*• ftauaavar 
5.000 1) and -oeojp t : ie Wit si momtership in. rlfl tiflflB 11 alt Wifi 01" « Huflt 
discjunti on u«tiptif>rala »fld l.ifi*" .ind set mtinn rfi p i l? flipn* us row un 
073{i B9;?a?, Quottna your AffifttS iiumlMr, or relurn th« CJ^jpcn withpiu'! delay ' 

0UA&wr££D fa save ycu more thart 

'any other software library scheme! 




SOFTWARE LIBRARY 



FARNH A V ROAn, L 1SS. HANTS OU&3 MJ 




HAHAB 



CDHESS. 



i j ii t. i i I ■ ■ a , ai ii:r.iHiiJ i i t ii h i ^■H' ^a l * ^'f »'Mj<*- 

...,„., .,,._. li^Kk»MidWl'U>.f f .O Iflf C 



OVEIUAS: -31 1 l*-r Is* 11 1, O' J«fl iit 9 ey l*i » n b' m;r.n: 
P-.:itri;f , r -tS. (Pilti -fir nkiii * Qtnnary. Jipnrvi'1!!! wn 75, 

U ."H \i/° Mlw^iil uwk'/b Hillir4i "22 E C uu ui FuuiJ. 

Cli.hiti * raotl Li+tI.* W ?K0 CKHnlLaeHi S D'j> 1 ?6». 
r.'jf.T 3wultarw Fr*m* A ll^y DO*) am I6rrt« .'nnr 



■t"'^ 



IX 



. • 



:a your ccmpjter, march ims 



ADD-ON 
EXTRA 



SoftRX 



Printer inter f see 
CBM 64A/fc<2Q 
£20.9$ 

Now thai the price or the 
Alphacnm 3? thermal 
(xinler has dropped to 
£54.95 Softer s Frin:erface 
looks very good value 
indeed, St allocs Vic and 
CBM 64 owners to take list- 
ings on ihie A pnacom ~Sd 
across 32, 42, or 63 
columns, This repreaenis a 
saving of fit leasl E13Q aver 
the cost ol a Co mm 3d ore 
dot matrix prhtev 

The Puntertace consists 
of a cable * hFch plugs into 
the user port, and the 
aaflwars on tape neaded to 
drive it. As well *s cftelng 
aduubis heigtit option H 
Handles Commodore 
graphics characters and 
s;regn clumps. Snce the 
Alphacom uses four inch 
wide paper It is probab y 
not suitable forwond- 
proce5Einc purposes but 1 1 
wrsry other resp*et 
compares well w t h 
Commodore prinieis. For 
an enarnplc ol itc print 
quality see 1h3 listirg for 
the Vic Basic Extensions 
article in inislssje. 

Ptinterfacecan also be 
czjnneccd to the Sinclair 
ZJCFrirv.er It is available by 
malt order onTy from Sctlex 
Compulflfp, RmimAmniilh 
Tel: 3202 422028, 

Oric Products 

Bus Co far 
OricfAtmoi 

A small piece of ofattic is 
available from Oric 
products to stop owners 

ffiQm bin why up their Crica 

whilst gropinp arourd tie 
bach of the machine to find 
the socket for the power 
jeck. It covers the 
expansion bus ard can be 
removed when you want tc 
pug s-omelhurg In. 

Ram 

Joystick interlace 
Specfnum 
£11.50 

The Joystick intfirfarm Is 
Kempston :onpatibe„ and 
will lake ai*y sort of "atari" 
type joyctlok, including 
quickshM II and rapid fire. 
Unfortunately there is no 
uunl MLiitiitn if the 
expansion bus. Available 
torn retailers. 



HARDWA 



Penman 



MBBC 

■ Penman Products Ltd. 

■ MT/ 

Is rr a plotter? Is it a rdhcit? ft it a 
mouse? No, iu Ftnraun, Set ibis 
K.uiily liltk- pCgCl down <T\ a piece 
of paper and away it poet plotting 
mikkkIi litn-v in rhrrp mUurt Yin 
ran ilsn draw curves uiing po jr up 
ordinal. 
With 4 JuiliMy wMtlJ piece -of 

paper on. 9 hljLh l-.jLi.-n.nn J, the 
Pcnmatl will in.iial.ae rrselfard Ihd 
the ■.orn-.v o.'the paper using tl« lijjhi 
Sensor*- Th; ttrct; pens drop in io 
their holders and the mobile rcbol is. 
connected tu iiii base by i ribbon 
cable. Dfspire i's si>.c it is capable of 
good resolution — O.C3mm — and 
tif.lr circles. Its r>er for trunks 
certainly .orc|ia-i:> well wiih 

canvenimnal fiat-h&i pl>nr J s- 

Not wnteJt with this, die Penmin 
can be jscd like £ "mnme", or a 

1 jji" lube cxdii ui.iL l.u<> nv 'j;mnf 

button, Two litlsi tensors are huili- 
h to enable the unit to fine the edge 
ef the paper ant. these can be used to 
cigiiLse pictures although i!ie 
i=-...ilur urn is rather low. 

The software is only a vail able on 
die and has a number of deriicmsti Li- 
mn rwirirm and ifilil ft Trie 
tti lilies ihov y tu bow n> iiicorporne 
command io 'he Penman i.ito a 
liask program, tx will *> UMijgiliii.L.1 




single letter instructiom. The soft- 

witi- car also be used vilh Ui; 
Acontiufl Lu(c« hnfrjaRt. 

Stwdtal plotier pens are used 
v.'.iLLrh aie widely uvuilablc n i 
variety of widthi aril colours. You 
can even uie j h ihiiblt PtnttJ! 

In theory, I'erunjin could be used 
wilh any ccinputer with a serial 
iuicifjLe iitiL Mine ifLUrrnaticn \\ 



given In Ihr n;inual en 
proHrotnming However, it sesms 
likely 'hat the mxhinc'i bis market 
wil be d achoMfi where it caji 
UciTiOhstrate tie simple principles of 

folxilk?;. Hill miphl ffimr it, Vi:tn.ly 

for plfttiitijj nesuli* or chars. The 

unit J| (.i:ur:. tui'j'iiJ :iuJ S.iould -l.nui 

up wtll i ii the clo ji r acini 

EiwironnitiiU. 

Seiovt and left: Examples of 

Penman s wot*, 




Oric Modem 

■ Oric/Atmos 

■ Oric Predicts 

■ £9&S5 

WINNER Of lUc L cuuinc soon" 
a*arJ fi)r late arriva. two years 
running, tbe Orir modcre, 
ainouiKcd at the luLnch of the 
Ofie. t h»» firtftlfe atrivtd. Otis ha^C 
slucli with tiicir policy crbadgine-Lp 
;i if icd and tested product and df sitn- 
h»j; a unUmi in:cilK.t. Tlu ijijvJc.iJ 
k p]u|gal into a ne w-siyle FT phone 
$<tcta And i he pujiir ts plugged in o 
the nodem. The p&oiir caa still be 
used normal.y. 

A short piece of libbon cable 
tjniucls Lhc expansion pori O itif 
mu.hII, sljm box Toniainin^ the iiiiet- 
f*ce wliiL'ti is iimTirrrrcl fn tIic 
modem by an KS4J2 cable. This 
interface wil be iuilt-iii to One's 
n^w IQI64 rnrrpucr vhich cin be 
connxlej o a *id^ rangt of 
modems. 

The sysiem seltware Is available en 



(ape or dhc and condins all the soft 
Wire ftKttSaJv io ox the computer 
as a Pretiel lermiml. Altaoufb a 
haH'-dipkx 1200 baud mode is avail- 
able ihis is nat used by t vr. software, 
and i iMi11iu.i!: itchiiLoil ileiail M 
■ r \i ■ '.■:( fgr he jser to lnenpt to writ* 
surh toflwart himself. Uric do mi-,- 
[hit 5>iik coTirninicaticin^ software 
il under d^vH Innment . The Ptke-I*. 
soft wore is p easint :o use viti the 
keyboard eoru'eit:em y redcitticd for 

l'n.'Hii L uuiiimi LLb, 

The compute r h i tmmo-y i: used a 
n bulf:r so that page? (lie ustr wjnsj 
to ilore are tiled, andtheadimpedto 
tape or disc cllline. 

For business users, a senimir 
company, Cycl h also mirk^tinc; tlit 
modern. Fwr in c£tra£4^you g*: the 

(aTio liarduunrr' Kut wtfith ite Cvt«, 

software. This is m impivve-Ticer or. 
th: Oric software, Lilthoo^h it is onlv 
available for the Attno-ii. li fciturcj. 
uuto l-'l .) and password transmissioL 
and has an offline meauKC buffer, 
iillo'.vni; maLlboi niessjgeE tc tx 



prepared tcfotc legging on, 

'fliis w^ware is cbvowtly (jnty 
woth it If yoti plan to jse PresteL 
very extensively. One ^npc is ibat 
yot can'r v.ew a catalogue of 
programs stored on disc. However, 
f r yi(*l dn ^iy riar mm uill j« wit- 
ware vpfirndw wh« these jetunc 
avaiUhie. 

Eerhaet). of je>ftViSh all** pages I* 
be -'ccfllled end printed on an Epson- 
type printer, double silt The 
modern was ccmpletety rcJibJc 
duiing teitinc; and the Klftvtare 
petforrKd eornpctantly, oceuion^lly 
get ijig lied, up wiih teinfisred tr-.it- 
mei,t. 3m for ihr price, i: lewis >ad 
\-alue for money hcs.de some new 
releases. Howivct, (his is ihe only 
moierr w.th Hillware desigaed for 
i he Orit, ilth«uiA Prnttt h[,vc mm 
in the pipeline which wiD luve 
ceoum.iucniow iortwar< at well. 

Mic;f.i".er h« imt |.l.iui iu :up^L.ji ilit 
Oric it the RMBlSCtj but much 
depends fun the demind from Oric 
owners. 



VGUnCOMPUTE3.MAfiSK19B5 33 



LOST 



The artifact is just too temp ling. 

.Sure, no one has ever returned 

with it but they didn't have your 

brains and courage. 

This treasure is worth any risk. 

An artifact containing the total 

history and Knowledge of a lost 

forgotten civilization 1 Just think 

what that could do for your career, 

for the university museum, and for 

your bank balance I 

Of course, there is the snal matter 

of finding it The perils en route are 

sure to be the most fiendishly 

clever traps and puzzles you've J0*>A 

ever faced. You'll need all your sKill 

and daring just to survive. 

Then there's the ancient curse . . , 

but what the heck; if it were easy, 

it wouldn't interest you, 

Dl J ones -would it? 








^H. i m f^H 




KINGDOMT' 




\ 




i k frd» 


" CASSETTE 




W y £9-95 


i 

¥ ft i. 1 \ 

m ■! 1 


:*" 1 ' 


11 SBSm l r £lt 

1 Hi i 


HI 





Tiisiributed In the U.K. by U.S. Gold Limited, 

Unit 10, The Parkway Industrial Centre, 

lenearje Street, Birmingham B7 4LY, 

Telephone: 021-359 3020* 



UlH(M( Aff «H 



Dl* Nt JOHE S IN TH E LD5T K I N iCCH , guftia clofenl j on* chit bhUji namei fine II ktnMWk din 1i*d 

1984 L .iceililm lid pncl Ulndiep:*. lot. All ftjfih 



1 Una dyMlnaicipt. hc, L .*ul(i«ntaOt»i. 



Star* 
chart 



Maze 

BBCB 

Acomsoft 

££95 

* * * 

3-D mazes have been 
around on none micros 
almost as long as bat'n ba I 
games. Acornson s is a 
h gh y superior versbn 
which enlivens the basi; 
concept with bullet-hring 
robots, fits, aid (as scene 
changes. Equally phasing 
is th2 way it mixes colours 
to decorate the corridors In 
y cargo of ;oclhiitj aaslcl 
shades. 



Labyrinth 

Baca 
Acomsoft 
Arcade advemure 

£3.95 

* * * 

Roam seven levels ol a 
labyrinth in search of the 
estrsorcinary Sevan tn 
crystal. On route you cen 

ahoct o" crush a variety of 
exotic creatures, or 
replenish yourself by 

eating fruit. The ides 
behind the game lis lar 
from novel bu: the nay it is 
executed — snooth scroll 
irg, superb animation — 
lifts it out of ne ofdroary: 
anoner conhrma'ion of 
Acomsoffs return to form. 



Break Fever 

CBM-64 

Interceptor Software 
Educational 
£? 

* * * 

Hey you I No mailer what 
your crew this is the 
plastic with a program lor 
you. Break dancing on 
cam 3 uter with a pre- 
recorded hack — dft? ywu 
bad Tews or just slack? 
Crucial, well hard, c tonic 
man too s:yley, murder — 
maybe that's you. 

Sl/lo.wacMd, they've 
gat all the terms; ify some 
wild style and bu*n baby* 

h trn Written -yy Hardip 
fVothada and Dernis Rellly, 
this game consisls of 
rron»pulaling a break 
dancing figure using a 
joystick, You can do 
djTil<t;y kfcita, space 
shuttles, heads pins, flips, 
back siams ard tackspns 



SOFT 



Match Day 

■ $p*Ktttflli 46K 

■ Football fiction 

■ Ocean 

■ i?M 

* + * * 

Thf thiii.i s otMttefi if lit Day and 

— no Jimrry Hill. To some extern 
Oeeui has realijed :hat football fans' 

drettm I'ilVt MvU'li F^y. Vo~ vxl[ 
over a year tntcrnitiemal Soccer for 
(he Gjaiiu'kiufL- 6-t has been un- 
<tu Vtnecd *a the tap football ictiDfi 
gam: fw any eonputer. Now the 
Spot t rum i* hack ii the running. 

Ol" course the Imitation of Ihe 
Sped rum's screen handling mates 
Marrh Day* graphic* nfriortoihe 
CBM-64 ga ne. But Otatn's program 
eomperuarei for ihi poore* cnphiti 
with subtler umiiKils whirh nllnw 
Tnu in dettlnp i whole variety of 
ball-playing ski .Is. 

lmjuj ii; M-JlchinK a mi cell from 
I tic I'V camera's £intiy high up in 
itic main stand . Thai's the view w» 
hiivt t>f i>c icilcn which scrclls 
uftoHhly as ihe play rrme! from we 
end of ilw field to he orh*r. 

Match Dry is a two-player gjuieor 
if you w.nt sane really tough 
opposition try cut ^our owa brand of 
total ffotbill on ih* computer's 
Intcnali final level. ll's the lop level 
nf »Nri«K nrrf S rvvtv pvl* j foot 
VfQfig, 

T!ie program's Amateur and 
Prok»*ion*l same* »re ilsn very food 
bur beatable, and they are th; only 
pbc; to start if you've, never ilayed 
before — especially when you ire 
vvitt; ai perkct the penetrating 
ihjoui;hbal]. 

Set pieces lite corners, throw-ins 
ami BLiil kicks, can be very finely 
limtd and crushirgly eff*cti;c. In 
situations l"nc I nest, as in ihe nnrmat 
tun of play, you cm vary the anetc 
and the poc« of tb* ball. Pfebtibly 

one of (be mod difficull lechtiqurs 
to master utin» ite joystick is the 
di*£L>ii4l trm^ficUi jnss itor^ the 
{mind. Hut once yeni hare got the 
banr; of ii ii really can cat the 
computer'* detents to shreds, 

( lulll: .1 |.J:.:.r, fjUl M: team tO 

inochcr accflrdirE to whthever is 

tLostH! in rhs bull. Althougb that may 
bound simple, tr^pp.ng and 
rrtrin-nlliii^ rhi* hal iiwH' .* another 
mailer. The unly way to do thai 
effect ivtly is :o *raieh he ball's 

:hocow ind iticvi \-our niao |i> wHtre 

tou expjci it it, lard. 

As tr.c iligtitly arihrififlutikirig 
players iroop am on to rne pitett la a 
lenticiir-B. df tic Manh tf ihe Cay 
music, you might wonder v.-hjt 
Jimmy Hill would mate ef srme ol 
ihe rcfcjceing&cis.cinstheccimpLi tr 
allows. Tht poals scored dim-rly 
Jnn thiowins woi_ld eerlsinlj niikc 
ihal famous thin drop in disbelief 
And meet eMnowtvato-s would toon 




run out of cl.tfic* if in ital maichci 
tbc b«li weit (J* wick unmoTibl? 
behind tke uult^ciAr .« a whol: 
h;-!:'.i a lime. 

Iini yon scon get used it trut — 
jum as you learn to li\e with had 



lee is tors o.i Saturday afternoon^. In 

mVi-'Jit rhtrc are enough nice d-eruilr, 

m nis pfo;ram to mrke jp br the 
JLiiiituitiLttiis. Ii*i iood to be able to 
■utie yinir own :-:iri;., (hocse the 
colours they'll be ^'earinri ii well as 
ihe cornpeuiion they irt playing in. 
All in all, f credit to tile came. 

Toby Woipe 




1985 The 
Day After 

■ CBM64 

I Mastdrttonti 

■ Tvnnst twister 

■ £1.99 

*!*-* + 

T ia 3AHI (itrrs four siars because 
it's vake for money :«-h»p}, 
Compared :s niher MuieiiiKmJi 
programs, this on* sat>w> great »tyle 
— m ttiuth h> that I laoueht ther 
wntilrJ hin'c it on. n dillereru pnet 
scile. Bui no, it\ still ^jod bai^^iti 
ba^ment stuff. The game iself hat 
nothing ft (towiti Aurhcny Burgess, 
G."ttrj{e Orwetl or American TV 
mnviej, about ihe thi'd world w»r. 

Vyu fly a .una* rrodule bokilifce 
(iff Us tsuncri pad, $. defrays along i 
tunrw , CAan up an J iiu inlo ouic: 



space. I'ostrion ihe lunar bue; oi?cr 
otic of Ihe bt ighlly coloured moons 
hanging tn rhe sky and you tnsrarlly 
[ejxract into a different landscape. 

Hvtc ycKti pb is tp toll«t lLtlc 
pin< dois nr nuclear plasma, as :hc 
tcohilkaly-ninJed term t.ns 
phenomenon. I'wmug UfOs — 
exactly Like the ones in the classic 

Geiry ^ncHi«n TV »n*r. *'l?FO" 
— hinder (He parnfrine process. 

L'sing the lunar tckports you can 
i.t.jni •:"! tit 12 .iKnr luiidsvjjo 
Kcsrdirjg to ihe inliy — I only 
managed nree Thit leaked r:dii'allv 
rit Here tit. JI you ire an ace spacer, 
you quilify to cotket the fusion care 
frntn the ta*t moq difliciih cavern. 
The n:ain prjbleii fur he novite 
space trucker is getting nui of (he 
harccr. One? you've mistered 
attitude and tbruiter Ci>mtOl, 
together with the use of the tractor 
jcortin'jca on page 30) 



voun com PUTcn. m a nci uses cj? 



♦♦.7 busy characters, 10 lost chords, 12 hours, 48 Traffic Wardens, 
95 London Tube Stations, 126,720 square feet of London, 
7 million Londoners**, 943 action filled screens • 



M 



M 



BROAD 




■ 



•: '-V --.;.- 






■n 



---:• 



""■■•■■ 
Tl 




S^IB 



Si 



■ 



H 






k* 



»#■* 



fis 



*p\-jKfrt 



km 



<»» 



■T"' 



begins 



ras; 










COMMODORE 64 - £7.99 



C^4&£ 



M£2 



oEEBU 



"•■;.;■, 



Sokwikuvii 



©1965 






: J ■ 



1 



I 



^H 





♦«* 



HH 



P3G 



•S7£V 



' E& 



KLffl 



^^H 




Star* 
chart 



Penetralor 



CBM64 

Mettoume 

Arcade 
£6.95 

* * 

llaited as the best version 

ol Sr ramble for the 
Specirum, Peretrator now 
makes a belated appear 
ance on the C3M 64 a 
machine al'eady wel 
catered for Sk-an-oie-wise. 
Ni>t one of the grsat CBM 
Skrarnbfes perhaps hul 
deserves a place in ihe lop 
10 for its ex eel I art 
Graphics, rousing 
soundtrack, training mode, 
and — a new feature — an 
npiu. n f.jf teoe&QniriQ me 
landscape. 

Pyjamarama 

Amstrad CPC-46A 

AmKn fi/Mik rp -He fl 

Arcade adventure 
£12.9S 

AAA*. 

EKceNanl graphics, a 
reincarnation of the gane 
ihdi dtirdu-tt-iti ao much 
P'aise whei it llfst 
appeared on the Spectrum 
Find the alarm clock and 
wind it up -o end Wally's 
nighmare. Yqj have to 
p ck up objects to achieve 
this jual. and an inrertiat- 
irg Isatjre is the way you 
Can change the objects by 
passing over them. Hakes 
som* software houssa look 
like rallies by comparison 

Finders 
Keeepers 

Spectrum 4SK 
Mas'ertronic 

Platform 

a. 99 

# * + 

IF yn.^vfi r\we' played a 
p atbrm game, then this 
ot© night 36 Arorlh a try. 
Yaur quest is to travel 
round the cas:ie of 
Spriteland, co lectin g up 
treasures which trie King 
has carelessly left 
scattered aroLnd his 
castle. 

There are the usual 
collection at baddies trying 
to ki I you, a maze and a 
large numter of screens. 
Yau car only Garry f vc 
oDJects at a tine, and you 
Can lhe.n trade trigm for 
cash, or be a yooU Tetluw 
and r etum them to ne 
king. 



(continued frcm pager 37} 
beUTn, thr came ixcomes a r;al tocrLv 
jLnjLcr — an ordinal jp^roa.h o 
1 he l.unir lender stersolypc. This 

gum, pi rj tiditfPWj* iri itw Mlliajtf 

that Master rOnic triec mi hard :o 
create in their fii« days; [ha: of being 

j r(.jl ihrtjl to the t.Tjbliihtd 
pficiiig Mratlurt of the Ifcrniu 
CHnputer soft wire aiuriei. 
P^ij/ Bona 



SOFTW 





Spy vs Spy 

I Beyond 

■ rVMt/V ■^t/i'yfPfu/tr 

■ £9.95 

* * * 

Espionage has come on a long way 
since lh; cartoon suit: Spy vs Spy 
first went undercover in a 1960 edi- 
tion of Mil J raagazintL Buckets of 
iv.irer, n e ml spiini^ .i-nd jruns rttach- 

id to pieces of string aie liaiJK (1m 

tooh of the cbak-and'dagger trade 
(hat Smiley or any cf his people 
would recognise. 

Muf together with inarrhist-typt 
boinbs with ijies and ;xp!odii£ 
ilarm blocks they rnat.e up tot ir- 
moury *ciu use to ourwii yum cp- 
posi-e nam her and to escape, frrm rhe 
embassy with a ziriefcas: full ofseeiei 
dco. merits. 

Two plajen car pliy llii-s maze 
jjam: or you car try your luck against 
the biacfe spy controlled by the con- 
fulvi , Yuu iau tvti. lUtk thu uddsiii 
lavo.ir (if your ipv's- mission hy ^ v- 
ing tlit cciitipuitr a low 1Q. G^tiic tp- 
tlons alio include «OOi dilTici.lty .is 
well as keeping the dcor leading, [q 
iIil trel-iwav p.anc hidden urtil ill 
ihc objcis iiavc been tt>lle;-ici . 




Stellar 7 



Although Spy vs 5-py is no more 
Than a maze adveiiuic flflhc coflcct- 
Llij-ubiiiL(i.'und-e-s:ap; tyittty., lilt 
splir-srrccn graphics and aiiirnsiian 
are very goot,. Ysu ran watzh whs: 
tiasiy suijuifes your uppenent ii 
preparing fnr you on Ins scretm and 
take efcttatt Kticu l?v tt'ilct.tinc liic 
rieht obi err ro pr'>iea vom I'm in n — 
ur.ibrdlas hiddeji IwhinJ al^^.MyL■k^ 
:<r. L 'he nnlv ai^vu*r rn ihe olrl hllflw- 
bchind-th:-dcor nick. 

To I he .iRht of rhe twe screens arc 
lb;. 'T'Tiipviatcra. Spies awittL ovtf 1v 
lh;m to lelcrl the booby-liap the^ 
need or m EfK* ai the map. 'I hey also 
show the obecti you are tarrying, 
and me "Line lei in iompk-te (he 
rnissicD. 

W l.i en you slmnblc across you: 
fi*al iecf:i uyen. searching lor ob- 
jects, it's liauJ-io-Iirtiid ejinbat Ume, 
T.ic only :>thtr opuoil is id run and if" 
ycu do, y-ju risk losinf;: ilemii. 

rhcuu cuzibat icqucncez art 
fo.jghi om with wooden clubs, and 
|h= ioystltk movement you aJr>p _ 
dei Ermines wiertier you trc joins; to: 
I |,ib to the stomach or the head- 
siua^iL Tiiu biei dies aad not onlj 
haii the irdignty 01 iiuucntig ott to 
heoven in (he form jl" an angel bu: 
also loses precioLii e i me. 
Tjby Watpg 



■ CBM-64 

■ US Geld 

■ 3D MEtchstick Tanks 

■ €9.95 
*- * + 

I WAS A 1 In I- S1ll7>ritril fo llnrf 
inyseircaHtibound in an Afiriesque 
Baitle Zt-ne M'cnano when ihe 
prcpra.ii ivur.uMy J.-jd^U — Iran* 
the CCii'cr picture 1 deduced that ] 
wu j Id be thrown bcadk'ii^ in.o sonic 
ihtct'-Jirrcfisional ftu ei ^'.m- 
s.hcot- r im-,ip, * roiki r.g ciraot in the 
vasiiims o" ih: cwtrtM. But irctiing 
arnund herw«n ih? levcn liar 
sysrems u\ ilie jmnic i> xhiTVcd by 
dririity your XCV Agl-2 Ravtui 
vtljcle stnigfrj ioio n W'jTplin,1c, You 
'.-■jib,' gtt co sec one of dies: when you 

havL' vinquishird evervlx^Jj 1 Ijieally. 

Gratbin^ a statistic out of rhe air, 

only ihfec nrrjinal games ha^e been 
wiilctj-. fen lie Cuiimiuduii: 0*1 — 
and this is obvously nrw one cf th:ni, 
Bu: th:n mast nuchiies, except for 
iMv prtiud and haughty HBt; Mi>n>, 
now hive a ctniiT.onahy af sofiw^n; 
ifiiit extendi fair bevond rhe 
uhiqniiuus Sptcv Invcder.. This is a 
siy.Lsh iiiiplemenLatiun tvitb some 
nic: fojehis. Thecasspttt- rnnr^ins a 
Raven MimuhI — U essential pro? to 
tho&c inttnl on living out the 
del j ;Lon that they ate an inttr- 
planeUTy tank comma oJcr. Qurc 
niji-J :ind si ycuhp. 

Onet yoj luve got your code rinc 
secjruy clearance you'll be ablt to 
appree.atc some ef ilie fiact control 
f'eal tires, There is. i zoom kiv option 
on the vievsenren which cnahleN you 
lv i4efililv distant objects. Naturally, 
vol hive protoric shields whose 
currem shetigili is indicxlbd on the 
blue .naujtL Icvraied rwi i he fight ride 
of your viewscreen b iae leflniwsl 
position. You can also render the 
K,tf«.n invwihli — ,i well hiov.i spin- 
olT of proteinic jhitd lechtioiogy. 
Onre you've got t.w hang of il] ihis ( 
yoL cin zo irs Tor ihc advunced 
drivin)i lest, 

Tips and hints ire provided: don'i 
refuel it u fue bay tin. it i. ii time to 
warp our, 'tie I -bays can only >e xtsed 
once. TJtere are Uts nl* ■ ariic-al 
manoeuvres, to Tias'tr likr "ihe 
move" and "tiring in the imtriir". 

Why .ij| ibii tu-.'hn&tocy ii iie^ar, 

*..ir-. vIitt! '.he jni/Diy is plainly 
i educed rn coi;slri!tlii.H its hardware 
liui iif jna cliMJLki liu ;i wifs been 
beyond me, Still ihe* peck a nisty 
punch, and as it Ml in tic mania I, 
the j^iidirg principle o:" all these 
ina KhEiivrts is simple; hit your target 
wirhout geiiing hit, koeeiving you 
loud and dear. Over ind out. 
Paul Bor.d 

icontfnuod or page 4 1} 



YOUHCCMPUTER. PAAPCH 19iS 39 



vrt^* 





MICROCOSM 



—the exciting computer competition book 

for all the family 

Somewhere in the UK or USA, there is a room in which 

there's a telephone, and an envelope containing a person's 

name. The winner of the prize is the first person to ring the 

room, and state the name sealed in the envelope. 

It sounds simple— try it and see! 



Getting Started 



Microcosm contains thirteen verses and 
Stunning colour illustrations. At the back of the 
book is a simple computer program. Getting 
started is easy: 

1 Type the program into your computer 

2 Study the 13 verses, searching for a 
common theme linking one line from eacn 
— use ihe ill astral ions : or clues 

3 Type in trie 13 lines you have chosen, 
together with a letter key taken from one of 
the illustrations 

4 If you've chosen correctly, the computer 
will print a message. When you've got 13 
me&iagcc, you'll be led on to the next part 
oF the puzzle. 



New Clues 

For the first time since Microcosm's launch, 

were releasirg two c'uta to help yon on your 

way: 

Each page contains a lire incorporating the 

name of a personal computer — there's one 

themal Only 12 mort to gall 

How much do you know about George 
Washington? — ic features in every pag«[ 



cSS^ 



£§§! 



M.crocnsm is available from W H Smith, Boots, 
Dillons, Hudsons and all good booksellers. 



£6.95 



Buy your topy today —and get your friends end 
family tu tjkt up the Microcosm Challenge. 



Pitman Publishing, 128 Long Acre, London WC2E 9AN 



10 YOUR COMPUTER, MARCH f$35 



Star* 
chart 

Mr Wong's 
Loopy Laundry 

AttS.Vad CPC 464 
A'iic 

Platform game 
ram 

* ■*■ 

Average gane in which Mr 
Wong hae to oolle-ct hio 
laundry whilst being 
pursued by a flying I'on a 
mush u\ aumJif 1 and soap 
suds that are definitely iot 
soft. The hard pressed 
Chinaman moves right and 
left and up and down the 
ladders dodging the 
hazards and collecting the 
washing. A pl£tfo-m game 
is » pl*t : orai gama is a 
platform game 

Brian Bloodaxe 

Spectrum <8K 

Tne Edge 
Arcaie Adventure 

f y us 

* w 

O^er hyped litlle number 
from the cutting Edge of 
Softek Features over 100 
screens h with more tian 
iOO faes weapons ara 
surprises. Every screen 
presents a logical pro blew 
— but whsl computer 
game doesn't? Graphically 

pedf!*lmn. fihmilrl havp 

been released on the 
Softek label at a mote 
reasonable price. Plays 
Sousa march, as per Monty 
Python — an old &BC TV 

COnitJiJy titiiitfi. Ufipttfonlly. 

Sentinal 

C3M-64 

U.S. 3uU 

Arcade/Strategy 
£995 

* * * 

Star Raiders is widely 
regarded as a classic Until 
now only available tor ihe 
Alar i, Sentinal is a 
ccrworcian Io iha 
Commodore. Your job is to 
destroy the alien bases 
whilst atopptng the ships 
from attacking your bases 
ard home planet — Iheir 
unmaie goal 

This requires a nica 
belance of defence and 
aiiac*, as well as speed 
ard reflexes. Despite being 
a classic in its time, it rtrtns 
look a liltle dated next to 
seme more recenl re eases 



(continued (rem pags 3d) 

Zaga Mission 

MCBM-64 

■ Anirog 

■ Choppe' hopper 

■ ff.fiB 

+ * * 

Tl tcus AAC so many h<:l><r>|v cr^mu 
or the market now lhal software 
cviewcii leaving their ulTizcs adopt 
t.tc tfrtuutitrig run peculiar to 
hrev iy-orimd pcork JiitTibirkin^ 
from Belt Hucyi innpen coinvry. 

Za»a Mission, slking two quid tJT 
your range Commodore cassene 
software price, hover! scine*'live 
between liic Kcr.rc uf □uipLiftcr and 
iiajuoon, but owes more to [lis; aim, 
i. 'it icresa display bcinp J Sim- 
[juar'cr 'ill »cro 1 i nj vi c w of q iorab 
Alley dutl;rcc valh conv&luTtd 
briekmbc giiiiiJie^d ij wunJc yon 
cyclic pitch, 

Miin carp; :hour this program? 
"iou can t Ely bickv^iJi — unlike a 
r-:jl rolcrcnft — and it's kind af 
sow: yotfd expect the iiitijoitiinni af 
plane I Ziea to corns up w Ih some- 
thing a ink more nifty For ihtuc 
Wtlh ■ (l«|rirtiiM* fcrnr ihrre orp no 
fuel Juirps lo torch; jicr can you do 
your soul ^uud b» v inching 
dm r»u.g]n nMctniUk fgurcs out sf 
hostile ttmrary. 

Plussci? Great tsounc — rum l he 
volume up aid pu: \nui cir 
dcfei der> on. Tac graphics are ["real 
r», but if is KHMtHKa hard to figure 
em exactly where you arc in re .at ion 
to obstacles — the 'copte - easts a 
shadow on the ground though, and 



Drive-in 

■ spectrum 
M Fantasy 

I Arcade advsntjre 

■ £5.50 

it * 

Good stock F*mai>- »iufT — lfi9 
scrccm, 2S diTcrmi -ilicn-y and 
v-. r ioui obi«:s tc be collided, 1 " itib. 
isuftwirc "Iusjh: verc a move siar i 

wluld bcC-iiut Kastwnnr — tln»n> i^n 
il Jul unvM.ry.iig furnuit lo all ihcrr 

ptoducis which mus" pri^urnsiby be 
papular with the mcr, 

This is one of Those gaiTte& where 
yon hive :q TeassTiblc youf uactrshir 
hy ti.jlict-iing dl the vaiioui bit*. A 
slight twist || ud„ted by the fact thsl 
tit cernrdt character — the Arte coinj 
at, i h = 7ippi ni about and zapping it a 
superriercinc k. tiled De/.2y. Ucjuiitii 
she ir.ay be bur j bit space suii and 
only t lev pixels make it hard tc icl!. 

What happcrud to Zifgy, the 

evttonif* tiar of ."un.uay ijamci 1 

Well, Dcuy is an her iv»y io heb 
him, l.unrd iito »rt abandoned Jrire 
iti by i lie v ill Jin of the piece she lias 
to piece logcthct an ok stirsii.p 1 1 
escapt. This invsi be assembled n 
the cornet sequence Hisioc iooo 

m. 

Vol cud us; a ovsick nt levtoard 



SOFTW 




this bdps j hi;, 'Trie aerial minouevr- 
iii| luhfi.Uy rcllecis the lendcrtcy of 
early lelicnpters to swing o: torcjuc 

— v\ wnli'li ynii cbn': bash jwnr rail. 

rotor j£an*t i will as you go mmcj 
co-neis, or els* ii's D1K-D1K D1K- 
K,VIIOOM'3rLAT! iT&-ln iu 
terra tsed by mature aduli comirutei 
i04irnn3ijt: while i claying win a glam 
of Lucoudc alter p.cking over clu 
fjiier pointsi cf a nice juicy piece Of" 
michme code,) 



Ko siviiig, ao ilauEhtcr - wmi 
i hen? The ."ciiijii you. ire ir tempt ng 
ibe*« mixes is nayx to kc?p Lp your 
ilielt ply? Nrt way, Jim- — ynirr .i^nal 
is Hi reich :hc nalftinctior.ing power 
[lliinr (|iai keeps plantt Zaga 1 rufe 
f»ii i ruirm'uL ruiiiiLt- bombardment. 
A* i result -if ihe [jrnU, sccirity do^rs 
are jpe.iing and cloainj erralifttlly — 
mm her hwiwrti Ytti can ps up after 
each mize — but the limitaton; of 
your opera ion jI ringe are a "kin.tk.-r 
handicap m your atrempt lo save 
your world A hclicopier of a game. 
Paaf Booi 




ta .ujiiMtl .In, .luractti and tbere.14 a 
keyboard tedefming cptictl. Tou use 
fccjs I -I to piek up and drop objects 
when DcEEy iv duecr.y 0''c:r rhem. 

You can also scare by s,lioo.in>t the 
aliens, of course, but when, ih- points 
see re reacqes 10,CQQ .t resets to sen 
and ttu p womagl ctimp.cted of the 
eame increases- You don't jusi 
collect objects — you can also trade 
ihtin for other nb}ecs and jomj of 

the rosnrc hovr luti. itiuiiu jjnr^ea, 

banks ind time michtnes These can 
all e nied io MSii' you complete the 
pamc. It's a Utile bJi nice a poor 
man** At it Atic, but for people who 
like compiling naps and puzzling 
over tunciiom ol gadgets;, I m sure 
it'll be a great hii 
Pwf Bond 



Monty is 
innocent 

■ Spectrum 48K 

■ Jremtiti Gmptitm 
I Arcade aavertur* 

■ £6.95 

GRtMtlN t'jraphics' tha acler 

Monty fire? ctm\^. lo fumainertcC ill 

Mony Mole — a gimc which trod on 
i lev ntrves wi:h its references to the 
itiii.cis" stride — cspcclilly in \iewof 
:he fact thai the author was the son of 
3 pi: safety officer. 

In aa irrenpt to reircis the 
balance w; find MoHy hsU been 

(continued Oft next pjg&l 



VOOR "OMPUTEn, r^ARCH 10SS 41 




Automan 

CBM-64 
Bug -by to 

F/afi'oro aid maze 
£9.50 

* + 

Cue of a series of average 
gam?s being boosted by a 
link with a i v sftfies. 

Below average qualiiv 
graphics oi the opeiinq 
s;r©3n — a tedious 
platform game — dulled 
any aril Hu si asm aroused bv 
the packing. QuaT ly of 
programs must improve, 0" 
home corrv>ut2r3 in ihe UK 

will jo heway of the hula 
hoop. 

Dam Buster 

Qric-1/Atmos 

UK 

SffHJlStOf 

* * * * 
No micro can be 
considered ccmclete 
without its very own flight 
RimninTir Thte i« Ihfr fir*l 

program for the Qrie/Atmos 
worthy of ihe name. While 

rxj( up lo the 

E peel rum/Con mode- re 
standards, it Has all the 
LbUtil teyluitfi uf maps 
insirumcniG and oul-olths- 
coct-pii view. 

The scenario is 
interesting, precision 
bombing, requiring tricky 
co ordination of speed. 
height and position, 
Fprhapi rvirf&tmos 
owners can look lor ward to 
further refinements of this. 

AftHJb#llC9 are out., and Ihe 

landing process : s rather 
abstract, instruments only 



Therbo 



Spcstrom 4$H 

Arcade 

srtool-'am-up 

£3,3Q 

* * * 

A sort of cross between 

nllcrball and Anren:an 

botball, Therbo eorsisis of 

rmlwr.t np a ta\l irntn lhf> 
computer which is trying to 
knock it into touch. 

You hawa a large armoury 

— for a ball game at least 

— of missiles, rresmos 
dud thus Lai. iu help yuu 
guice the :herbo tip the 
f-elc, and frustrate the 
computer's efforts lo do the 
same. Mice g rap hies with 
sideways scrolling, anc a 
tricky game to master. 



(continued from uret/iovs pagtf 
icdixrcd to deal np ma I aw lias bcrn 
imprisoned for 'his 

J l"ic u in of Ift BJmc is for Mnnir 
lit get die- key ftoir. tfce prison 
EoVUCkr's offi.'e .Hid CKSpC* He 
i units. :»iin ill Tanniis screens being 
pursued by pi.son (ifTiiL-n, ghosts 
.tiJ siu mi. ]U' iun nwH: from icrccn 
id screen by rushing oil' the side 
sliding up and diw» ropes tir by 

billOlt dOUVA hfllpi. 

I'knii of irtagiiamii has been 
used iu .icjil- ibe backdrops — [here 
arc i voi.plv ol rood 31} mi:cj and in 

ingenious scipiLTK-e in > ^ymntiiuct. 
Money received from sib-sol .'lonty 
Mob; was declined Tor di nylon to 
ihe Miner's Welfare Fund — riimfh 
ii I he titni- of' jEoiig o frcsi. ibis 
bod* villi bid rot mud: up irs mind 
10 Kveni ihp gift. The Af-iuef's, 
TCclTan.* Find ii ji mtaHishvl 
chanty which exracd nrur to nc 
Mrilfc No vjlIl Jon it ions arc panned 
(hir. unit , 

A mnpcicn Hid ]»raphioi!ly 
inventive game, 
*W Bond 



Gandalf 



■ CBM-64 

■ Tymac 

■ Shoof 'em-up 

■ £9.55 
* * + 

Osi Wiu-i i» haw (bought hat a 
nam; like Gandalf »-ou"d create a "ot 
efccpyr-glK problems — i*|jstiim£ ihe 
*titnini*irai(iri «~ rhe Tolkien esraic 
ni;ik.-!i a vim from iln Rxir.vi.miis 
jttiTi pliJiiU'jblf bv compa"isrfl. 

SpKiibiion npn. this is an iagcii' 
uu^guipc villi ver* nivc n'lphiti. fr 
tun florhing whasocver to ite with the 
Lor4 of (b; Rin^f, *Mrt frwn Isi- 
iucksi^ (lie M MJTc;rtr's nirnc. 

The s-reoi dispby shows a Ctcfc 
^'atl with Wo tune's. Li the djujnet 
iiter T Bcktsh-Ic sauruni jk uil- 
flinjj rhrou.ch the tulgcv' w<h»Jj. TIum- 
arc m Tad Maly- ailol li^jrd men ken 
m mgmmi ihtti » t 1 1 m. -, ii* libdiwial 
invejmriu by r«lieviti|; you, ti»tid;ll, 
of your irMMirc which & pr.iicticd iy 
the cuvomaiy aiiiicm \[i'H. tturd 
parr:, fife and theft. In otter vgrds. 
it's ^iiard-s versus bzjirln . 

'I "he sliiTiv rk-piilcf irtimdto xhicve 
-:il-h aim h* jhJuc:ing your appren- 
tice jiiJ botdinu itii-i-D for rrnsoii. 
You can prevent his, by dutcttig 
Iphminc belts down o:i the vile kd- 
unppKti-. Tnc loyuiek eovrtir. th^ 
miH-mrtii i>i :b* wtiard and the 
iliri.-<iioik of \itt [jov.'cr. To direct die 
vi/.id'i [niwcr ymi i'lst move? die 
tros'.-ha rs around the smri nrxt then 
prcsri etc Tircbuton, To rno-r the 
wizard iim«ll" arnund ye-j Juw* to 
b^ild dywi tlic buiion aid ^■agjile die 
itvys'uk. If voir rowtr drair^. v:>u 
hjvi to sliift ttle riftroowrvitT jp the 
ihimn^ tou-;r iiarpish and replenish 
hfc h!»fr*ripi Trrnn ihe thm-ii^ vtm 
There a * deadly *p.der knvkmi>. 
ifound bvluml I he bjttlcnenls aid 
Itkt uiurf Jfiiiil trHcliiuJs it k'j%ta yiu 

feelinti fretiy Mck if yoi h»-np .nto it 
Zippine, trie lizards urns then into 
told wins. This II ci" cntdal 

iinpnitjnuc o [bt: stfiiid Siiitco iiKC 



SOFTWI 




ikf wnv>n nf r^-ptili.-K arc ii> inexorable 

ihai noner or law ihey arc howid 10 
g» pui the gaie aiW make otV with a 
ra«mber of itnij i-nurh ippwttasitkt 
!* italic. 

Bang 3f food employer jtom give 
chase, an-l sc- a power l»li cup ;ii ihv 
path of the iiiard man. When rhc ir;ip 
d^slnuyslhr izardyoucanrctriereilte 
apprcniia' by bnistin^ apLinsr bin 
and rauminr; to ihe o»de. 1*hei you 
b*«e :o leirieve tae I *p. Yem CJB afco 
collect rf,c gald coins lying iiround. 
But js always - remember to -vjldi 

ojl l">r die "elk'W oil rich 11 w^l 

slfiil the LT)ins, lb? brsl voittpulM 
giicieT alw^Vs Iilvi; I nioml o! icirlii; 
kuii , ii id n 's inif iIilhi yuu win'i no IJi 
KTMy til life if >«u watth OK fur the 
y:liow ostrich. 
Paul tend 

Back Track 

■ Dragon 32 

W ln~ertive Software 

■ JP Maze Game 
U Et50 

* # * * 

ho, we liavun rurfmirn ibtiut itc 
I.'rag-Mi. hut a lor of ihe software 
companies have. 

This r:alh does -akc iht \>ngm 
12 iu its Knits You trc jitven an 



overhejd neu, of one gf the ppotw 

with Eddie in ihe middle. 
1. transpires tha- Eddie is held cap- 

livt hv trt- rud firofesjQr who ii 
cruelly plumb :ii'. ihe mnermest dep- 
ths of the hiirran psyche. A& i worse 
tor uretltan wiTcliingciiJJcoiirc-mns 
ol I he J'.n i l!'vini:ts ibo^ 1 , tnc pro- 
fcMOf has designid n tericj of five 
labyrirnhitc it*ts of iicreasiig cim- 
plcxity lo see if Eddie's will to live 
car be broken — bis will lo live is 
shewn ;rs t haroneter on ihc left of 
the sciicn, OViecli are automatical ly 
picked up 4ft JRdxht 1'ir.T ■ o rorhm nnd 
hii willpover is boosted. Eddie has 
to reach the ciii. Undine fcey« in ihe 
correct on cr hei'ort he clr g:i out , 

I'TCSsinj; the M key displays a map 
— I' Ivldic hiif fovnd it — and prcss- 
iiiK an'-' <ii'ier key relnrna you to the 
main dkphy. 

VC ; aieh out for somc^haT s.lsepv 
serpents and the profs pet 
geiKin.illy-miiMted rag, which ob- 
jen-ii In ^e- riy witljicci vn .uu Tiiafh. 

All i-i at;, ar en erjwisinj; rflor by 
Chris Andrew and wlial tt pity wit- 
wit companies d dn' 1 pridu«.e ntuje 
of this kind of quality soft ware be in e ' 
the Dragon hid the rjg pulled Pom 
under it. 

Psul 3ord 



d? v OUfl COMPUTER MARCH 1*8S 






Premier Rrcacfes 




As licensed by leading 

American Arcade Game 

manufacturers to 

DatcKoFt 




THE ULTIMATE LH AMERICAN SOFTWARE 
FOR YOU ON C1.S. GOLD 

'J *> Geld i> »|r.»:tri hy all Irad'ng rOFHf Lit' >!■ r-» hi ■:!«)! rig- 

rjmmm whsmith wildings wdouvww 

i-Msn^'flnd characters are trad^malis of B»lly Midway Htj, C*. *?19S0foi-the rVes:ern Hernupltsre TridamarkJoJNamcQ -ld.^lflBO ihrouflhcut ne rtst of the wcrit). 
Learned to Daiasohi, Inc. by Ma rrco' America, Ire. DigDus."ii designed and ufigirmnwJ by Nf«tco®19S2 LicersecJ ta Citlaiuft, lnc. r by Nanco-Amiflce, Inc. 
Vr. Do is a iNcfenarjcbsf Uriv?TsaJUS\ Inc^lM*. Daisafi *a *eis:ar«) trademark of Efftmofi, Inc. Premier Arcadei mtrwJtmirk af Qstisoft. lnc, E 'T934 DataMift, trie. 

All rights rest/m. 




NEWS 

ooeo 
rssu 

tf t t 
h h 

The crystal ball 

VtSX mice owners — r e- 
oice! Leif©i 9 Ccmcuting 
iave made all of their 
:elebraled adventures 
piusilabic on cassette Tor 

^our micro. Priced at £.935 
sacft, sued superb g arras as 
Dobasal Adven'ure, Adven- 
ture Quest, Dungeon Adven- 
ture, Lords Of Time, Snow- 
33(1 ano HetLrn to been can 
iow be played on your new 
vtS<. Vcu can't call yojrself 
an adventurer until you've 
axperienced am of Level 9's 
oroarams Worh huvno an 
MS* for. 

Father than use scrulfy 
"3ld p.igc^ lorn out of a 

school rough book, you 
2oUd do no better than in- 
vest E3.95 In «j pad gf DO 
^dven.ure Plarner sheets 
frorn Print W Plotter Pro- 
ducts, bach large Sheet is 
Kigh quality paper p-e 
primed wilh 153 inter- 
connecting location boxes 
The sheets are ideal lor 

designing your own tdven- 

lurers or keepino, art Im- 
pressive permanent reccrd 

5( si corrpietec game. Cx- 
ccilcm value, 

A helping hand 

Adventure international's 
Soice er o Clavmorgje 
Castle is- obviously giving 
quiit^ a few of you adven- 
turers a lot to :hirk abojt 
Once again, Scott Adams' 
mischievous mind has caus- 
ed the heavens to ring w th 
pleas for help, Here's a 
mors© of assistance: 

Cant get up lo the oft In 
the ballroom? 

LLEPS TH6IL SAC ^EHT 
REILESNftHC NELLAF NO 
DNATS 

Nothing useful m Me 
kitchei? 

STENIBAC EHT Ml KOOL A 
EVAH 
Haven't met thcdrtgoT yet? 

NWOD HSUP DNA MOOR 

NIALPOT OG 

Yours in castles aid 

caverns. 

HUGO NORTH 




Our man with the 
trass lamp and 
the key to a 
thousand 
mysteries sheds 
light on new 
adventure 
programs. Lost? 
Never fear, Hugo 
North is here. 

King Arthur's 

Quest 

48K Spectrum 

£7.95 

HI 1 ! WacGifrbon 

Kino Arthur's Quest if a grapiic* 

and i«0 idvtnture lhal lil.es you 

ihi.m^n Camrlot, currently under 
Mcrgana's wiorry spell. 

The iijid is spin Jim nyiii ntcst: 
Merlin's Tow:r — where yfu start, 
[he wilderness, eAcfotOttd finest, 
keep, chapel, crypr, civern arid 
Mfirgfllrt's Castle. Each area is bised 
Oft it Vl'vl «l I ■ l.v JO sQLarcv. 

Every rime you move, ym progress 
one sqjare and are presented wirh a 
iorw.ird view of lh. % laffcunding 
area,. Fermanenih' M view me E*- 
jiI'.i: which slowly rums, red is 
yciur lifc-focce dfimtn Lilies and u pk- 
turc of every object in yrsur 
possession. 

N, e bottom ul I it screen is used as 
a scrolling text wint.ow, recordng 
you/ cunmiiidi : nd aLLowinfl 
Gryimlkin the fat, yo'jr i.u'hiu" 
an:i]>aaik>ii, Li> fLrni?,h informarion 
on abiteu, incidenti:, etc. 

Comnur.ds in pwn bv single-key 
entries Yeu d^n't hate to memorise 
them — a fceyfcoard overlay ttpm Mr 
cd. There arc onlv cighr venous ynu 
can per lorn: urn left or righ:, move 
forward, t*fce, kit'c or use an obpcci, 
car. drink nnd nisi a spell, You can 
alio repea a desciipiioii, «ncsl a 
command, sav; ard r?sto"e i gaoc. 





Anaoj the dunctcn '.-ou'll sn- 
Hjur.ierarea lesrer, grillln, ani owl, 
Cru-nc-trrs niaj bet]) ;im — if yju 
help Lbem. Thr grjpbics, :rc jiniplc 
bill tffitctiri ard the ttxt ihu.'aci:r- 
Ect lias been deigned to look like 
l lithe nti: mailufircripl. Snirif snniH 
i:K\:s have be^i iivluJed, An tn- 
juya'^lc |j;ame of eKflinraiion and 
diwovcry Jar [hi: ygflingtr tdvin- 
(urtr. 

Runes of 
Zendos 

45K Sp&ctrun 

£7.25 

Qoit&$ SvfLwtttb 

ElNOOS IS AS a ii mil id graphic and 

rest Adventure * L kh sor.it iimilaiit.ct. 
to its pffeckeeuar, Orarlc'i Civs. If 

jnu tiked ifert, [hen chances are y&u 
will enjoy t'.\h one, 

The screen is div dec inu two, [he 
top i all" displaying a side-c-n view of 
purl of: a rocm which rtirolh ItcriMn 
Tally or Ttstt .cally in response to your 
chosen movBiiMil. Tbt lover half is 
n,.J fui cKUul ■■ ui;runiil:. jil1 

ccipsnses. Commands cm ran^c 
frorri the tene — t for go left — lo [he 
verbose - Ettack (lie guard with the 
Dii^hly axe. 

You are shown is a smatl while- 
clad rigi_ri; vhuse nissi'jn it is to seek 
out and desrrn/ (tc vicktd wizard 
?*rtrfrt^ H^ Iih-4 i.i-|-.Ji :<ir1y impriufcii- 
ctl tnc spirit of cash mnrvh — ysu 
mus: find and release all 12 spirits, 
Eauh »ectio« of the xude ii split Ibjo 
several chanberj. 

Since :ach of the spirit? is loeaerd 
ii j Jij'.kicn teeibij, Lite program 
kind.y lets ynu jnovs instantiiTiequjly 
Irnin section 10 seeuon wiu a iin^k 



command. EtTeeiKdy, you ml lo 
plsy 12 cijniKCTcd 5ub'ad% r ennjr:s, 

Ap:srt I "Otti your own waLkaboutv 
thi uiiimjlicMi mostly comes 'rom 
simplf tr*lised built s ^ith maty of 
th2 eharicters vou meet. These 
cbar&Uehi, at in Onctc's Cave < are 
solid!} 1 pi«serited and imag:nit:vel* 
Hi-iif.niM As igtcl ji lightinj, c.-aclo 

in^ runic Dodts ^mi casting spells are 
oner rnapr activities,, 

An «n iiuiijimi ad^tniuiXj Zendni 
works oui very veil If you winr i 
change ftoin lea only advctitires, 

this should fill the frit, 

Project-X the 
micro man 

48K Spectrum 
£3.2£ 

A kovel and enjoyable QciHcd 
jJvl- n-,ut. An accident has 
miniaturised you and the qut;$i con- 
cerns your it'cmsis - o ntun lo not- 
mat, You IE hntdr with i mole - In* 
w.iatj given your dinunutivc diTien- 
lionS} will yoii use lot weapons/ 
Oi-cr ISC local it'iu., 90 vbji.-a» and 
original puulcs ensure good volu: 
for money. 

The Legacy 

43K Specrrjm 

£'.95 

Tamsoft 

A's-o r nii=n' QutU-OASCO adventure, 
your sectntric g-and father ha* died 
or.d Honied you »■ aotc lnvncluiiry. 

T;i claim your inheritance, you itium 
tiist find the secret vault by rcjUon- 
ins a ir«!urc Trail of tint* let by 
grandpa. A noivviolern, pleasinil/' 
JtreKfaJruj, liv.i ddvecturc. 



tfOUH COMPUTER. MARCH 1980 45 




SPACE JUNK 



L&Hng l. 

199 REM***** SPACE JUNK FRE-L0H1JER **** 

119 REM** COPYRIGHT 198^ NHL IN 5HHRF1R * 

129 REM** RLL RHjHTS FOR SPACE JUNK * 

130 REM** RESERVED Fr" NHL IN SHPRHR * 
1 40 REin**************************?**^*** 
5608 F0RX*9T033 

5619 RERJJfl 

5629 P0KE49152+X,R 

3039 NEXT 



5340 SVS45152 

5930 REMtttrVC DRTR TO LORD NO IN FILE** 

5000 Bftlfil53> I, U2 

5010 DHTFU R£f1t*CHflNE5E TO 8 FOR IU&M&* 

5020 DFTR160. 1.32; 186, 255. L6S 1 / 10* 162. 26 

S030 DRTHIfiRi 192.32, 18?, 253. 163,0,32 

5040 DRTfl2l3.255 f ?D/«/64- 83/ 80-65.. &7 

5056 DRTR59 1 32 . 74 , 83 , 78 i "5 



Nalin Sharrna with the 
first part of a joystick- 
only game. 

Space Iunk is a fasi. all action, muchini-rovli* 
game for mc Commodore fA, It features ulna- 
tmooth movemetu of all graphics, including tlie 
ine scrolling of the planet surface. 

The basic idea of "he pant is u- iruve your 
spaceship across the pianei and retrieve 12 
latdliks whidi litter the skies. However, it is. 
iu)l very l-.isv as [her* 3fe foui jurckies patrol- 
ling the planet attl muching thsm Is fatal 

Tlit- game is 10K long ;o ii is bc.ng pg> 
lishid in ihr« parii. To enter ths pmera-n 
von will need to type in three listings — lsting 
J bdna the first block of object code for Space 
JutU. Ii wjuIJ he sensible to use ihrce filler- 
em casseti-s - tall than X, Y jnd Z. It is 
imperative that cassettes Y ind Z irt C33, 

It you are working will disc, chang: l he 
following: 

Line 60io in tsting I as instructed. 
Unes^l6and30l5as instructed, in ist ng?. 

If yon do not feel jp :o typing i3i«= program 
in, ther. if you send roe £3.25 — ctcques/P.Os 
payable to Nalin S harms — together with your 
nan'.e and iddress I will be happy to send you a 
copy of Space junk on » fit-it loader. Send tor 
Wal.ji Sliatiitu, }f K rehener Roue, Wahhaot- 
jlnv, I j>ndon E 1 7 -1LJ, 



First of all,, type in listing 1 and save it on 
cassette 2, but after saving it do not -ewind the 
ra^Cj as later tbt object cods must loliow it. 
Listing 1 is the preloader Tor Space Junk. So all 
il docs is <M*t up fh' b^rnai to load lilt objeci 

code file — one* loaded it will hi- executed and 
i hi game will begin. 

Now, be/ore typing in listing 2 } you must 
move the sort of Essie upwards as folhwi-: 
POKE 32768 (RETURN! 
POKE44.128 (RETURN} 
POKE43 h 1 [RETURN} 

NEl/V (R=TURN) 

Now type in .istiag I and save it on cassette 
X List big 2 is (he code-aid which will allow 
you to enter : he object cod?. It is important "hat 
before lidding or using lsting 2, the star of 
Rfsic is moved as shown above. 

Once jou have shacked tatting 2 and jrou 
have saved is, you can ncgin D enter the object 
LoJe — listing 3 So type Run ant press Return 
and you should sec a hrtc-oitkn menu, pro 
vided ihsi lining 2 has been entered correctly. 
The menu is as follows: 

1 = ENTER CODE 

2 = LCAD CODE 

3 = S*VE CODE 

After pressing 1 you will be apknx from 
whicb hex address you wish to start entering 
the code. This meant tbat you don': have 

to iitvut A\ I he code ai once — vuu wtiuiJ 
be better off typing ir, only t few 



hundred tines a day Sc if you haven't e.itered 
any Spatzt Jmk :od: prevJousIy-j type ir. OiQO 
and press Return. Now the compiler will print 
"OSCHP" ind will await the cn - ry or the ine or 

coce. You Jtm 't hdvi- in type ir the hat aJdr :S4 

every lime you enter a lint. 

When entering a line of code, type ii il*e first 
16 characters w'.iich rtpreseni c^ht bytes of 

cote, then a Npact*. and .hen the last three 
chsraccxc which represent a checksum of iIio.il 
eig.it fcytei of code. Once you have typed in lhe 
linej presj Kerutn tad provitk*d tha: the line 
has been Altered correctly, the computer will 
print "OK" anc wll go on to the not hex 
nd-cres.; automat iculh.'. Ifiln. lint 1ms ttm been 
enured correctly, she computer will pnnt 
'TRY AGAIN" and you'll ha*e to re enter the 
line. 

This sT,-stcm cf checiing the code a* it is 
entered ii v*ry eHlc;ie:it, nn4 it will Vii- I-. 
improve the zhnnce! of tlr program running 
first time. If at any lime yru wish to iciurn ro 
the menu, to save the code so you ran return to 
it at a later date, iiulcad uf entering a line of 
truth: precm '""" tnd then Return, 

Optbn 2 allows you to load m prtvioudy 
saved code, .V.ake su j c thai your disc/ cassette is 
ready and thtjl press "?"- Tile code will now 

be loaded. Option 3 allovs you to sa^e me 

ob|_-ci cude. Just make sure that y?ur di?C' 

(con'inucd on page <8} 



L.sti.iy 3. 




■mv 


^FFP^FFFrFCFFS-'Urt 


(58? 1 


?? RE 


rtFF L F)-yFSE.7E7? - = 


e?H 


BA88: 


00FT;C5CeFf:C8C3r? 


--: -i 


nyt-ti 


coTce^peuecEtei?*: 


54e 


B8DB 


c 'Ffl??ffl"SF183FF88 


33? 


«?B8 : 


7EE7E7F8FSFFFFrH 


6Bfl 


BRR^: 


83 7c;C5C€C (5C57 .'84 


4Z6 


M?W':: 


C91-8r9l8l91Aj8?E 


ItE 


BQE€ 


FF8333833f3FFF88 


ZES 


89B5 : 


7EFFE7CFOFFFFF7* 


675 


?^:1 


80f ccs c€ c c nscx* 


?EE 


EP9ie 


'■' ' ,;j'.N::' ,| .!.rL 


+4ti 


t»*E? : 


PTOJ?30it-3S33> t f r iW 


z?v 


09C8 


wt-H't.ft.frt'tt- {% 


Kr F, 


«h*«; 


mi 'i i sc?7i:El£rS7t 


::>■ 


PS IE: 


■ i r.^-.-'-^c^rc 


2CI 


.';-'h .' 


FF833F3F?FB3f f £i?R 


2C« 


83C9: 


7£FFFFF3£.:E7FF7= 


SB 5 


8RR? 


88FCT383C38383838 


2 LC 


09 29 


e8CiC6"f7E8*8686 


Z'F. 1 


ew-e 


FF833F8F3f83IWW 


2E€ 


0998 


0i?08:*f iy«GiRL8eig 


168 


PflH-i- 


08C6r5Cr r .-*C.6CS7C 


528 


B32& 


( i «PEf:e"oiBf,i*-:'>v'. 


Jr; 


6999' 


Bii»HOi=nici(ar>npi(>fiPi(ig 


iJOl" 


n^ipri I 


.E'flC'iC?* 1 'i--iin>:i- 


1 :« 


WBJ : 


bqc e c*cec5c err; j* 


4?2 


n? 'W'- 


t¥ /C C6 ." DP C Cf '" 67i. 


v,.. 


e»? 


^2T8-i:F';Fr:F0l-ifF48 


4DI 


09E« 


8^7838 lWl^ieiB?3 


138 


PRE? 


0«C 6C5C € P6F EE EC* 


53R 


©838 


P«FE8t?C I33^3fi?»? 


1F« 


8918 


FF73333??383FF*I8 


3CI' 


0?E5f : 


0e8B8e7E887E«083 


BFC 


8flCi« 


BeCSEETXra/CEECo 


4?8 


9948 


ef?cw*67i:cfr:e7t; 


4*r 


e»|B 


CF fl T5 7 1 "^ *r*3"* F&S 


2CP 


09FO- 


tw^OPGiCOMOWiif^ 


oeo 




98cec*ce: rc^c-c;rc 


^le 


&?*?■ 


w7Ccc:e7E9ec6J^ 


3CE 


8?^D 


y F Tr^SHF^S^'^FFfl© 


2D? 


89F8 


H™i1£i(jPPiP>f:OPW).>?i5i 


f>00 


8RP? 


DBFErEHTereiFSFE 


«*'4 


WW 


twtieei'8F-E5oei0TO 


AFE 


m f -- 


^^^EFECECEFFija 


0*4 


8FI98 : 


7EC3IlFEFPFDBr;^-iE 


^JF6 


?uj, : 


FFFEF^FECFQEF r 8? 


6?3 


8999: 


^ ^itci^E F£F £ ?880 


2Ffl 


8838 


'■FhtPfchEFRFEFFfa 


e«8 


8H0B' 


8e?i ;i;€TfiF fpf^ s;r? 


l^a 


iftfit-^ 


I- = Hftl- - H PP b RflF ~t^ 


**9 


8908 : 


i; ■L-Mi---t^h L .-hv = ; 


4 Hi 


,>-^..- 


fFEfKFERFFEFFF83 


SUA 


"Fll'- 


BBFCeSflSTCeMSeF; 


48C 


^RE3 


| -'hhh i --EFEFEliF=8e 


5«4 


IW68! 


EeFEFFEFEFEFSFE 


^a r j 


..-.),. 


F-HF'-FHFtFFIFFFTf 


we 


8R18 


88/Cr 6C8C ^ C8C 57: 


tra 


PRF?' 


FFFFFFFFEFPFF=?P 


639 


HC-'l.l 


'■-ii 5BEC6P$CjS7<C 


ME 


8848: 


88828HFFFF88Be*8 


?^)M 


8H28: 


B8FCS««E«£fi««€F: 


^6 


ct H k - 


np00£iJ|^?_'tjyvigl^M^ 


*F0 


gf "^B- 


r fifty r,.' »"MFSF?T^ n ^ 


•i-et 


tf»tf • 


ytlHHM^h 1- L H)il,'IJfla 


?*2 


0R28 


W?E^8C0Fr.C8C0ri 


4F8 


83tftf 


0890083P38W8388 


96Q 


Bfli^rj; 


FF^F'!iPtiFDFDr , 5F p 


.'?! 


y?5e: 


GP)RgF|'?FF (r FfiBti«yBei 


S1E 


8R--I8 : 


88^t f .'8L'0Fi:c9r0':^ 


?r?R 


paws-- 


ai»tj p H38 c«i . gyg pt 


819 


©pes- 


FF7F7F7K7F?F97r*F 


4IW 


896?: 


FF^FF^FF^FFFStftFIH 


'4E 


3R?g 


8e7CC6C8UED5C67: 


4fc« 


»E*1? 


TOVW^BlP'-tOSP '■ L 


tJih; 


QPS»0- 


FF F5DF" I ■ F 51'F P5T r 


rrn 


■..-.',•:: 


FFFKFFI-r-F'I'rFFrFF 


'Fft 


grf*e> 


ettC &M* 1 . sf ttL*LO"^?j 


5HK 




^HllSiPnil WHt«F i = F 


1F.C 


B?*»8 


FF5FF7^75tFK%/FF 


6M 


8W8 


n«p»(5ww,p,n ? e ei 5,ft 


8?8 


8H«g 


88FC3838?l?^0ci0F: 


2E8 


ajt^ 


88888 *8 ?F F ^ F F' > ■■, 


IFF 


88M : 


e888^BFFFF888<S^8 


JPE 


8*78 


?E?8??fF t -?8??rE 


ra 


8H^3 


<?87E:ei5]ieDsn?^a 


iE? 


'*:■- 


^ftflF^F'Shlllllllf';" ■!, 


IH 


PRPft 


■c acac^fFreooesf 


3B* 


e?ee 


7E P 3? ?9F F^CS»7 F 7E 


3B3 


9R^a 


oacecGESFccccec 5 


■:«? 


"■•• 


k f. y u ivitviini'iHt -ii^t; 


IFF 


mm 


■ i ' 3C ,-' r . 3C 3C ?cr^ r ' 


IE* 


8288 


FEE 7E ?"????£ itrVE 


>:h 


PFtfig 


^er^.^rgcergE^Td 


■:l£ 


»B^ 


88?CF2FBFE7C33ie 


428 


men 


FFEFESEEEFEFFFFi:: 


rn> 


0^8^ 


7ECFr?Fo8f9:-f r 37E 


5E2 


BR6S 


BetL^-EfeFEDtTSCtCT. 


?on 


88^8 


" T ECs : SLi* , §981'lt- ■ 


'..'Ir 


gee? 


FFEEEEEEHFEEFF08 


66^ 


0598. 


"r'EE?'E7?F?FFFFf-PF 


r.i>^ 


HR7H- 


ftBT«ESF3^EDecECS 


fi? 


^*^e 


V^r ■:7-^=TMFir '■-■•■i. 


532 


88C8' 


FFRftFFBflFERHFFtii? 


SF? 


"WH : 


■■£FF' r F?F?FE7E77e 


\ 86 


0R7R' 


887CC6C5CEC6C672 


■IDE 


f»B*.8 


tCis?lFFFF81C3re 


5»2 



^6 YOURCCMPJTER, WARCH19B& 



■IDE 




) tCi s SlFFt r F81C3?E 5»2 





p 









g;r)..j.UP 




IP^if 


9 






■ 


9 


a 




i-^'^T' i^Lt 




(•"■-, 




IfLf'TIH 


jpm^w* Ha| «j^i 




B< ■ 1 




■!•«► * 


•^u 



Listing 2. 



\" PFHtt » iPFr r 'ii n C( L'F— ill i-» 

7« PFnttf l-fipi^K.Hr IJflS fFfll4 SHH="F «T 

Hi Ii'"i- iR*«|n 

\»i\ l*Kfl.WHn,».FOr£?.aieL. I 

1 n r-=-|r,TTB * i-pnri vi i ■ r TCC nra »■ 

19 f*" IM ■ nun > .' i- 1 L 7' n ', *> 

US '■tvi\-Kn mi - si't'Mi-.- 

IH t'lUPTI K" ■ L'JIiJ ..'LL' 

HU KENT'S FJB ■ '.H'L .JLL' 

iw ccrv*»]rv^ ,,, T icings 

[ft DHVB».Bin Wf»?«? 

m? QUTotw 

■jw kin »»* twEt :ost w* 

J.B JHI 'UT '♦•L.UlL.f IhTLV lUKI » Htt'lH 

II* ijcsuiUM 

j+t lni»3r »Mn- 'nn 

.<5? c-im ::.^iu»L «(!!(■ rFnimnnBih! hi* HSSttiH 

JFJS 1p"HX»»-'» ,, 1H!H«TijM *F2n»«»W tKSTM 

inn ni»« **nf* i t ttW i piT^t'nplfitr 1 *' iifirf-* 

j*U -^-n[li',iv« K.C7 IrbMatMU'.tl 1ft* 
»mh •*wii<tmA i nt-»*i*h •tn«ii>fiii mM luni 
*ib n*f,W.UI ■»!-£•"! veMtmfJtKt. Ht<l LUi • 

-ii wtrr 

*ai t4i" ■■■■-h i c* ihii . 1 1 Ji i Hutu ■■Mm is*ct*jM 
■Hie wgjizne 

*1fl [■nT''LMr'HEHF'» , rMT-«J?*'-FF>'' HGHlH" l)«->l»-H <MPU<*e '1.^*11(4 LMtOVlflt 
*-lt IjU'UJW Kl"»*>tbt W LUUI-W* 

irpe iitn -•• iec-hex «■ 
:»:* JJ-J Ni-- 

;a?B :FS-ITHF:nFEHiF<h 

:t)& ' FJ /€5.1 j;C*Ii*?Tl-FhPf 11 ,PM 

; 5*B > UK ; ■ .' ". «t I fcr ' I 

isse ;fz< tf-em-.- i -e ncTr-iee? 
:•'■ H'l.-lM'iv >*["■■(" l;*i j- ' I 

?1H« IFH'' ^Vl-Ft* I I* 
' I»?0 nl-Ft'CI-H'."-!! J i»J#j 
llklU JUL. 131 

|ilie hl-ht-Ch-FI'i-i] •■;- 

ViJH hFvT 
KM MT\HH 

I7SB FFI' ■ + * -t-.f.-lf-- ttt 
]/]* JT-lf 

Ltz& *<** .l«-n*i 
lilti lF=hL.'*T-tH|i $ 

u^«r rt* t'^.tiisrl*-L 

li« i*-F*K<1I[»:Ht.i. It) 

1I?<£ I"^>tB1HI>(13!? 

1JF» i."-jp 

1!« ■I'OTO.JLB 

I *P? *-R--i3 

1?I9 7I»D"»- H< ■Iblin.-l i i 

I JV"» "-h-vni 



BH5B rti'.h\--r.-<'i?7<: :.'E 

IIH-M ' r KP;^]?^ r :?6TC p7 E 

■SBiwt ' t u t.-y rTr ■ r r r j_i t' ' t 

n j r_i :j . pfjfj p^iej n n r k i ejf/ih tj,;. t ;i 

ftj.^c! Scu^n^^ij-rjci^icifiCiiSillPi 

tUh-n * 0@O093BWQ|rQ8BQ 

gjfte ff.1«ft3Ei?PBR»R£iPiFiti 

BB3B- leiOlBJOJfiieiWB 

l?FE^ e0f1900FFCig«?0F1,-ViR 

y^.y- taawjetiFiBiieietie 

esrie idiBiaiPtfeeeeeua 

?i<b* ^sf.iCFFicrerraEK'y 

<??F?i- t F Sl.Sl?l?lSL9lPF 

5SFC FFC3R , 7:-???9R7''r:-iFF 

i u. n y : FFE78?ErE7E'E75Ei 1 

BC20: FF^gp^^RlFSF^FS 1 

i^C2S FF©l3F3FB3Ff 1 3Se3 



582 


ac?? : 


^; ,f 


0C?iB' 


a 1 1 


BL'Ha : 


.Hi. 


ec«s ; 


i?yti 


a:.7>a : 


^KiP 1 


ecso 


9B u 


ac?a 


F1I- f. 


BOSS 


Hi OP 


5C7?i 


HP" 


?rr? 


app 


BCB3 


B88 


BC88 


aFF 


©GOT 


13*- 


pir '-J- 


H"i* 


«CFiei: 


] 2B 


acpis: 


?4F 


0CBB 


243 


acue: 


<!iFjn 


eiCGfi 


5a* 


B'XS- 


6W 


BCDB: 


ITJ 


acse 


sen 


BCE8 ■ 


3BB 


BCEB 


S?C 


Wf-tA 


W€ 


ar=s 


33£ 


aoaa 




F r !?T ,i 7? : ?Fa"S3?3357 2FS ^EB? 

FH?]F9F3£'CR:fCF 640 aria 1 

r-'- : ?-.ij?-. ( ?sir^r.' : 7 H e ' 9©C pp.? 

F F^7T3? 19 8 L F 9?'.^ w? 4 2F D£ : 

BFSFFeiFaF'nRBflftZH 4?2 0DZ6 : 

1? r int;«. fJP^CT?^!!? 3^^ OI)7>9 ' 

0R000aT'0SPllS0^0 0C4 0DT0 

HH,;> : 7l4]414 , ?04ayU l'9t 0D*0 

FFPTp(jFf?F0B?HftflFI €Ct BTUR 

F PFr3c7i::^^8FlF:fln 4ie aDT<0 

t, ?M0^a^a , r5!! i i J0?a zt6 0D?? 

CBFg3C3C3€ 2 B ff gB 8 33C BP6 1 ? 

fn?H0?0!!0*'ii3sei7ja« i ?ep em/y 

0Fr?FfBFB F 3R?F>0^a 4FE ?UW 

cflF03f:;3C000?a0?0 22£ ?dpb 

HeFi0"?0 , ?07?i3i7:ari?p 24 f ^bsb 

FflFrpiRFj^B^BPi^ne 32C WHS 

ytiyyigtiPFiy^^V' 1 ??^ 3FH BI»BB 

?F3F3FfiF0?l?(?peil3a 3?C BHrB 

r-hr-Fh'l-rFMaHiM^fi? 4H-. aDCg 

FF^FFFFFF^B^FiaFlB JCC BD3B 

FQFcrcF^agppaai^a ^ds bdjs 



=T*F'=1!.I PF H l h *""HHjE : '' i f^<I ? B1 * I *:>* 31 S*" 
L..jv t «j Bi L , i-J. L'lJL . B 'J«£FSi. !» 

"T-'ir^J 

L " JH " ' OTSfcH J I <U '.JJL-nn" 

^'F-qB- : FlJTi-BJ. ; 

^JttrtJL L kl:i— 'H^tL't ■.' I KKE 78! ,:| i fCf SJ4M* 

FTifTlfla 11 FCF-TFl] *■ FO«'»I-"SJ 
NjKFiCT ] , l" Fr. r-i-;, I; Fl.th_."H,iT] 

K«rai/iW F7>EF?i.)j; 

F*TI*t. 
= HWUM H7JJJ F4.E f*ini IN 1FH*** 
1 m.»»((;i j ■■jm- 

1 «=:*^-i 1 3.t>J ■* • 

■ *.~ ti- l j i-n . m 1 . 'ii.'i >■ « 1 ■ ■ 

I ..V <f 

*tfijW< 



HPFI B^0 5 ?"'P 5 ?"i mp ? 

l-'-rF0F«?Fi1HeR0H0H0 
^l^.TT'lTjlT^aTjSlBB 
rj Z;t? I dl -■ 5 5T 5 ? 55 kJ9 
H ET!i0?0"i3 5?^ ? * 000 
FEFaFaF?F0fl0*10fl0 

Hefl0"50Ti3t!e^:^00 

2E2BI4141*?'^?B0 
F pp PF F 7 F r«fl H^RR 

p^h^«w;b^0^0w 

H€Re3454 1^1414*0 

f- y h wif. yh pK Hfl^ pFtf=fl 
?r 3C?C 3C7 8 R0 H «0i? 
HFH2^0'ria'?0^«* , 5B*ftl 
5efTC04t41'i 141400 

►iFSFFBFpFFFFFeFB 

t-FFF*??ggFFFFfiei«? 

C0F94C3CFCFC9C3C 

FeF0F«FaFi?Fa^» u 
0?0 a Hwapia^H wf f PF 

3C3C3C3C3C31 H*i B 

FFFFF0'--aFF t FFeF0 
FFFFBBWFFPFMIJ8 



MC 


?DF5 


3C9 


B0E8 


sn 


flDF* 


64 y 


8DF8 


884 


?E0P 


199 


"F 1 ?? 


2?0 


afely 


898 


8E1S3 


1^4 


BF^PI 


2?ft 


?E20 


130 


■SE30 


f*r.6 


«E3% 


224 


h;- an 


ZM 


9E48 


234 


MF'Ml 


*>■:• 


MtT'K 


238 


"EFPl 


arc 


3E6B 


IC4 


'Jl- PB 


60D 


i?Frs 


3FC 


^E?P 


if© 


oes» 


5tE 


i,prj,-. 


■>-f 


k^e 


•ilft 


PER? 


rtc 


?ER= 


'M_ 


f/jiifi'/ a 



rp !: 03 r . jiCF0FP?i:3r 4?0 
0F7FF>.'FaFFr-FF?F? 68C 

rr'FPiFHitBf-fFrPMe 3fc 
C8F83C3CFCFC3C3C 498 

00"?00HP : FFF?aa?ap ife 

FFB?33?FlF7F3?r3; 734 

^'FBiiFSFassFs-^i ?ga 

t F^l3f3F03?F3 t ?F 2BE 
FF«3333Fil3»3?ei^ 310 
F p ?3 '.< j»3S0 ! 1333 3? ;!^e 
FF03C :: GFCFCFC C 83 Sl8 
ff? left ?E7S?;r?8P 5 3 

FFJF3^?*3F'JF|-ei 2I»R 
FF??11B1233??333 2.E 
FF?S'li , FJ l ft<l£i'J"iy? It* 
FF833?3S39393i93 322 
FFCi?3?33e33F3F3F 2?4 
tjp 833339392933173 j>B2 

FFS?T;(3F£3F?3?ei 432 

FFB3CPCFCF0FCFCF 53IC 

FF3*333?39?SS»5fJ 3U£ 

3 cenfi.iued Crt rd*f p&ge) 



Y0URC0MPUT^R,MA=«CH1S8& 4? 



(continued (torn page 46} 

cassette is re;dy and then press "?". The Cvde 

win now dc iaved. 

t'?e eatsiiit: V Co save the objtct cod,: umil 
you have finkhed upitifi all of ii jo. Then you 
car save t aixer listing 1 t>n cassette Z, This 
shoulc' ihen give you a compute top? ol Space 



Junk, It can now be badici in iht: rormal Shift 
and Rufl/Stop wsy, and hopefully ii should 
load and run perrccd^ ■ 



Sa& next month's issue (orihe 
Sftcrirtfi pwt cf Spece Junk. 






(fisting 3 conVnuad from previous page) 


0EB0 


FF393939393303C7 3€S 


1138 


0EBB 


FF393939Z90UJ39 2lE 


1158 


0=G8 


FF381 IS3C78311?y 368 


1 It0: 


0ECS- 


FF393S3381F93303 368- 


1 168 


0ED0 


FF0l?lE?r7SFi?0! _-"-:-; 


1 178 ' 


0=D? 


00000(l0000£00IJ00 000 


1 178 


P;E€ ; 


?96BM!W9W?WB BBP 


l isf 


9EES 


090005 0000800 080 858 


1)001 


y=Fe; 


008We 0000000000 908 


ilW: 


KJff 


r-tif+joprvi]>fx<?Ch:'<M BOB 


11^5 


0-0*; 


l.1tfM,iyi;l_l0gfl000PSW;1 0S»?t 


1180 


0-FIF . 


0003^^0000001700 $na 


llftO 


H- IP 


00ft*0P00FFFFFFFF 3FT 


llBft 


0»lt> 


FF000 5*10" 008 000 0FF 


13£!!? 


0=*$ 


PBsaeeeeofneoBFF 0F- 


lt<78 


0-2£: 


C8C3CeCPir,lKPirpce 689 


11C8: 


0-3* : 


ccc:3;33tccc?:*3^ 3f: 


11U0; 


9-3^- 


03030 c039?830~ 83 81? 


11D8 


0-40 ^ 


00009000trOC;3233 1FE 


11E8: 


BF46 1 


l-n-=i-'.l-y<'0E0Ce80 701 


1IE8 


0-30: 


0381030303038203 013 


L1F0 


BF5£i 


18l3lSlF:Fl81£18 0C= 


1 1F8 : 


(j=(5e: 


B003B??!8?'F8» i ? , P0F BjC 


i^y? 


eF6e ; 


]81318lF;F800e98 885 


12DS : 


0F70: 


000i»90F8F8igin8 233 


1218 


Pfi"r 


oofl^fimiPiPrtFFFF IF: 


1310 


0FH0 


0903091F:FL:Jl%L8 88E 


1228 


0FS9' 


181318FFFF030P00 24? 


1228- 


9F?a> 


000000FFFF13181H ?4* 


1 ?*0 : 


0F98 


]Bl?lBFBFB131Ssl8 280 


1Z30: 


SF-0 


i;K«;0C0cec3cec0 683 


1240- 


0FR8 


E0E8E8E0E0ESE0E0 70S 


1248 


8FB0 


J0FF80FF0BF~00FF 40C 


1238" 


0FB8: 


88FF0eFF98F i 00FF 3FC 


12U8: 


0FC0: 


^f-h00FF?9F-L : iHFF 3FC 


1250: 


WCB 


08FF*»»"hWh--iifl»F 3FC 


I >-* 


0FB0' 


00FF00FF08F r 00FF 3FC 


12^0: 


eif D g 


e0FF00FFP0FFO0>F 3FC 


1Z>0 


0FE0' 


6^f--|--n^rP3rT08FF 3FC 


1S55 


f- -.-: 


90FF00liF00FF00FF 3DC 


1238 


9FF9- 


08Fh0HFF00FF00FF sfc 


U?8 


0F^9: 


eaPFeeFpngFFaePF 3fc 


12M 


1000 


890fiFFFi=FF7C7C7C 471 


1230: 


1008 


1-yF'BFFFFFFFFFFFB 7E3 


12PI8- 


HIV 


?E3E^EFFFFFFFFFF Tlfil 


12B0 : 


1918 


1FFFFFFFFFFF1F1F 338 


1238: 


1628: 


OOBflnfltetrcP.ai 91fi :fst 


12C8 : 


1029 


0B0ft000!B808l98W0 Q£3 


IZC0 


1030: 


^009001 81 B0&8888 03" 


LZ3B 


1039 


FFFF3FF31F333FFF -*EP 


13^ 


1040. 


f?00ei@Fl 0^706181? 851 


12E8 


1048' 


e0?l»?lB1CE3f5BC3* 5BC 


lice 


1B30 


?0P700flFey0F0007 02C 


12F8 


1636 


e0g«0008B00908e0 i8« 


12F8 


1KB 


FFD7D?'JJ?B7D T P7f , r i"W 


13TO 


1066' 


FFD7U7IT71J7D''P7FF 70S 


1388 


1078= 


1F1F883088000008 03£ 


1310 


1R78 


FRFRRf^£ieaei#BB0B 1F9 


nig 


iese: 


f-FEBE8EBEBCeir;0FF 71E 


1320 


ime- 


FC0C8C3CPC0C0C t '; 240 


1328 


1890: 


FFFFCF-CFF3FFF-3 6FS 


1310 


1098- 


fff;ff3Fffeiff=f rgt 


1338 


18R9 


FFE8FF-FFF87FF=F 6E: 


1348 


18RB 


B1B1 093060098890 18? 


1348 


1BB0. 


wiy .yyi!Mt:u0i3y0^0 10Z 


1330 


10B0: 


fJ00Pi30^0FF00H030 8FF 


1330 


15C0: 


FF0rtg0?pi6000y0-F 1FE 


1JW0 


ieco : 


FFF=FP&?iPee0*)Flin"r Z^T 


130B 


iero: 


FF8:Q1S1£18IFF30 493 


137« 


i ere 


F>e:ei9l£l8!FF38 48>( 


1378 


1<?E0 


B0Qi9089C<?88'OO838 «0M 


1369 


net: 


0JPlPi|?t00?i3(jyi30Bl.>.i0 PiH(« 


1388 


IOF0J 


0000 00«H?00 00030 B0H 


13?0 


19FB: 


00pigtwi9B:?gnpein4ei pipib 


1 ^^H 


1)00 


8000F* ; FF>FF8FP-8 3E5 


1380 


1)08" 


F8FBF8FFFFFFFF-F TE3 


1386 


1)18 


IFIFIFFFFFFFFF^F 3W 


1318 


1J18 J 


FFFFFFFFFF1F1FIF 55S 


1318 


1120 


9M000'E?E00l9].0 12C 


i3C0 


1328 


t" 0*100 F1S:«00*»00^0 001^ 


13C8 


13 30- 


WWlBi'tiLlWMyW PR3 


13P0 


1130: 


FFF?3FF33F333FFF 4E@ 


13M 


1148= 


000**eFi0878^1013 831 


13E8 


1115' 


e*wiericc0jH>0ce4 asc 


13C8 



lQFTp 

03t1i'0a0/000700i?7 31 r J3P3 

F-P7D7!i7D7I??PPFF ?SP |4W 

F-FFjo'i'^B^njprFF r3e i4i« 

8r8F8k f '?8090C0wy0 1 IE 1419 

F 1 F 18'*0 003 ?0 00 IE2 1 420 

r-t CW0E8EJESE8f F ?1E J 428 

FC0OBC0C02OC0CFC ?4f 1438 

FFFFE77EF-PFFFF? £Ff 1438 

Ffirvtrit^F-riFPfF pfl*: l-f4iJ 

F^ICFFFFP-FPFFPF jF£ 1443 

(,, i8300O0 , ?30ii*,'W0 90^ 1438 

r .W.'OTnin<?iJL-i*Ol0«:<fty 10^ 14t*5 : 

0O000p»"0F"000C r 'i3£l yFF 14i58 

F F FFPI M*ih y i , 0EK , P i FE ' 4<jj=l : 

eeFFypFpeft e aa a ae 2fb i^: 

FFCICKICICIPFB? 3C3 M?B 

FFS38303B383=Fn0 *flB 1488 

8i?00i 1 0i i iyS'i?8?*JPi90 P R 1 45*8 : 

B?0 8008 n?ip 0030. Aft ytjti [,;«)«: 

fii"'00?0iiyyy003Ci*iB 900 ^fl? 1 

WltfH-H^f-hFFlFlFi 5DH [4RS 

■W^-SFBFFFFFFFF 7E3 |4B0 

¥KHF3FFFFFFFFFFF 6RP (4F3 

rrrF-FFFinrifFF 3?o i^f 

000030X3C801S318 BF# 14C3 

00003000 000 000 H0 00S J4pg 

E3u093Biai*#iij0?egi> a^i? j*i;'3 

FFFF3FF33F333FFF 4E0 .4F*: 

0n001ES10fH20S7 086 ,4E3 

0(*y0i04BCgBPRlS?a» FR :4F3? 

0s«739P30ae33ee7 Bi4 ,4F? 

0000?0r000C830B0 2i?9 ,308 

FFP7P 7 T/P"FFD7FF ','38 '30B 

FFB7--Fr.rli''D7D7FF 730 i^H 

C7r;730e00000?0«0 ;8E 1?18 

E'?E3?0E0000030P0 :C6 :32:B 

FFtCCPtCPICfKRrftt-F frMb !32B: 

FC8CBC?C8C0C3CFi: 2-*8 1330 

FFFFF3SFFFCF=FFC «F9 |^3g: 

FFiFFFFarricrrF ew i3*b ; 

FF83FFFFFFli;-FFF 6?9 134?: 

0&06-P000 0000^0^0 00C ]3SH: 

hHPP|nnppiPftqB?0eP BCB 1 15St(' 

0>300000000FF^0P0 0FF 136«- 

e^FFFneoeBoeew ife i368 

6B8880FFFfFF30pg zFD is7r 

FFfliHiRiRiajFFee ^23 1373 

FF03B5B36383FFi?0 '3?' 13S0 

0H00B0 000 0000 000 B00 3300 : 

vi|-iyymjt^|Wt1000000 B00 ]^i'?0 

000095 0000 000 0P0 000 ]t'^0 

000000 0000 000 0P0 B00 l">fm 

FFFFF8F8F8FFFFFF 7E3 13 BO 

C7C7C7FFFFFFFFFF 738 13B8 

FFFFFF1F1F1FFFFF *,*& 15CB 

0O00«01^18001S19 068 13C8 

8600308800008800 B0 P ISM 

8e00i0:-»:3Ci8080n bfupi ispm 

FFFF3FF33F333FFF 'Eg 15E8 

0B00;C222?8B1017 997 1^8 

8008 7088E 0100080 1E8 13FB 

0007000300030007 014 l^FB 

008008C00BC000R0 280 jfing 

FFTJ7P7D7FFD7.VFF 730 1*h? 

FfDTHft-HWUfJSt-t- f*fy 1616 

E:E3*J0000C»00«B00 1C6 16] S 

C7C7«J0080B88e000 18E H3p 

FFCEiCOCECZtSCZ'T C8C Lb^H 

Fl 0rn( SJ^LHTRrFT 440 153R 

FFFFF?8=FFE7FF7E EF? 1639 

FFC7FK3«;FF?/h»-FF «S7 151? 

FF70FFF=FF83FFFF 6ED 1545 

8C0C8&?3eeeee0iw eie i63B 

3E38900?0088n8f« PfiR lfi*iS 

0^00*300 388FF 0088 CFF 166B 

BeeeFFF-HpflBoroBi IFE L66B 

0F00080300FFFFFF ;FD 1670 

FF?191?1?1?1FFB0 4D3 1671! 

Fra9E9990999FF0| 4flB 168E 

Bt J 08080908000000 E00 168E 



iif>f]0 , P(?0nFtB30iia9e 
0000€0000030F000 
B000FFFFFF:7C7C7 

FFFFFFFBf=e=ytiFFF 
tI3E3E3FFFF'FFFfF 
FFFF1F1F1F-FFFFF 
800081.4 1 91 H:VJ 18 IB 

0000?B 1C0B?8^000 
0000*01018005000 
FFFF7FFF3F3F2FFF 
yyy01L2227i*B ! ' r 'l V 
88CI070H3E01 01 ' 
009?0t!870033t807 
Rf!SPi**ii_ riyijc 0*"0Mrt 
FFJ71FFFD7D7r7FF 
FF1i7IJ7S7F B !'7[i,>'F 
Ftii 88Q0 s 5P ^^rifffi 
B^^F 800n088P80ifl?" 
FFC0C0I. W.UC^CP^F 

FrB CW-ft CMC hcihc fc 
FFFFFCCFFFF JJFF3F 
FFFIFF8FFFE1FFPF 

FF9EFFFFFF T 0F>FF 

l $ : ?00y HyynyfiBC'n 

) B 1 5000-^00000008 
060008 0M0800FF0B 
0lflM888Ff F F 0flP*?nfl 
FFFF800fl000008FF 

F F"??K^¥?83??FF00 
r F? 1 919 19 U J FFW 
f 1 Fin g FiJiFj g yi : ni y ^ yp 
n-^ii h fi _»n 0000 ypinyi? 
eeo00?eiwi3O006e(p 

00B0988flO000000f 
00P8F-rFFFJfF8 c 8F 
FFFFF ff FFF»FHF«*fF 

F]f IFtFFFFFFF^FF 
FFlFl-lFKFFFF^F^ 
000P03?C3C'fl0 1 31 S 
08000^ 1 C0M00y^0€ 
00801 ?3C3C: 80^08 
FFFF3FFF3F3F3=FF 
?J?»eit21W-il2iiZ,* 
000 030 45-C8 F00 30B 
0007800 S00« 30 307 
yy d ygO C C0O 080 115? 
FFH7FFD7il7B7jJ'^> 
FFD7rin'7B7FFD?FF 
F9F&0<t0?eeBeo3e0 
1FiF000030000388 
FFC0i;8f'0C8C0C0FF 

FCflC8?8CHC»C0i Ft" 
FFFF7£E7FFF C «FF=)F 
FF7r;FFE3FFr8FFF c ' 
FFCiKif-pFFBEFFFF 
30 1 J00*0000000B00 
0CEC000008000K08 
08W000800e0FF00 

08 ^"0 ecr f ff ee e 

30FFFFFF 00000000 
t Ffe3850W^^FP0B 

-FFl«';HlHH'lFFg0 
3060090000000000 
30088ra008e80000 
?FK^wtmmiwnfm0Pi 
3000000000P00000 
3000FFFFFF1F1FIF 
p FFFFFFFFFF8F#FS 
=8FSFSFFFFFFFFFF 
1F1F1FFFFFFFFFFF 
508008 7E7E?w wiB 
J0080?1 C0yi?00?l00 
300000181BE0B000 
FFFF3FFFJF3F3FFF 

9B00 i eriP37eoi<eii3 

0000]FIR4E0ra0404 
000/060 p' 3007 0^0 7 

FFFFP7D7D7D7U7FF 
FFU7P7P7P7D(7FFFF 

_ rjr'C09 0030080 pen 
j'E3£0B00?0000000 
FFC2C2C3C2COC8FF 

KcececBCBcecetFL 

rP-F-yFFgFFFCFFCF 




Pl?5 


!«»■ 


0?0 


1680: 


332 


1*HB' 


7E3 


! -,PO 


7^1 


1^88 


^38 


16C0 : 


C*50 


IH H 


02 C 


I^D0: 


8J0 


l*B0- 


4-B 


1*E8 : 


6?r 


]-.£8 


1E8 


1«F0- 


0] 4 


i6J=e- 


tf:ft? 


i f m 


730 


1700: 


738 


1710: 


1E2 


1718' 


1 1E 


1728 


£71 


U28 r 


4C0 


1 T 30 : 


6fif 


1738 


73C 


U40: 


£78 


1740: 


83 


1759: 


038 


1 738 


6FF 


l T *i0 


IFE 


1768- 


2H« 


1 T 70- 


4Hff 


1770 


4>S 


1700* 


000 


l'S*? 


000 


j-"(* 


080 


]"»* 


000 


] t|R 


4HH 


I'FtB 


7f3 


I'Bt* 


?Cf 


1~PB 


y?8 


r:rj 


0M? 


i'ra: 


02C 


!*D0 : 


0*8 


1 V D8: 


4f8 


. >:0 


«*«? 


I'ES- 


IF8 


1 T F0 


8:4 


1 T FS 


lr>fi 


1¥00 


■ M 


1908 


730 


1818 


1F0 


1B13 


83E 


1B28 


67E 


1823 


4C0 


183i? 


6F9 


1B?6 


6112 


1040 


scs 


1B4R 


0*0 


1830 


018 


1838 


0FF 


1R68" 


iff 


1B59 


2FTi 


18/0: 


4?r" 


1070: 


8S3 


1880 


0P0 


13BB 


800 


1080 


m 


ies*y 


000 


18RB 


3?P 


10RB' 


7E3 


1BBB 


7£3 


10BB 


5?<= 


1BC0 


12C 


)8ce 


02C 


18D8- 


8^8 


IBD8 


4F8 


IBE0 


eci 


lflEB : 


27C 


19F0 


a 1 


18F8 


368 


J?0? 


738 


JS08- 


738 


1810: 


HFR 


l?18 


87C 


1328 


606 


1<"28 


440 


lOIPI 


6F? 


1?3B 



rrirFFFeFHej-FhF km 

FF38FFFFFFC1FFFF 6 F 3 

6060000000030000 BCJ 

os8eee080ODW0p8 t>vz 

000008B8800300FF 0F- 

(i((J|plrtplPHHHI?)F'FF00 1F- 

«08a3PFF" : FF-0f50& JFD 
FF8103030383FF0O 480 
FFClClClCiaFFOO 5C3 

000 0?0 0000 30000 003 
00008^00 00030B00 00? 
0080089000030000 083 

0080808880890800 083 
BBB0FFFFFF3E3E3E 3B7 

F8FFFFFFFFF-P-a=S 7E3 
FC7C7CFFFFFFFFFF 66 r 
irif'-rffFFFrFHF Mj 

000000FFFF0B1B18 2Zi 
0000081 CP8000008 021 

p«H9ia3Cir:ieoBe0 0e5 

c FFr.^FF5F3F3FTFF *F3 
00000F) 88708181 3 0!53 

ClHF1PllKRrIF.HllHHaCI4 Z?! - 

000 7 '000F0g0F000/ 02^ 
"?0B 0008800 000 000 183 
FFD T B707Ii7rji7I»7FF ^03 
FFP'D7D71V7D71I7FF 783 
3E3E0080B0g?IBe80 07: 
7C7C000000030B00 0F? 
FFrRrF-CRrRC3CBFF &F15 
FC0C8C0C8C0! BCFC 248 
FFFF9FFSFF75FFE? 6F« 
FFC7ft'fitH'WY'i'H' *>w 
FF8rFFFFFF33FFFF 63? 
C8C30t 00M0030000 188 
«-ir_n(;fC<0fl0? , 30?80 Q8f- 
\: l 1 (11 -M r-e?p 900 3 lh.'F I- 0F L 
0"0i^iT»00003FFFF !F= 

flTtP00Pfl0B(*F-PFFF 2F0 
FF81tfI^l?lBlFF«0 4?^ 
FF8181818181FF01 403 
80080080080^008 0fl^ 
00800080«0038008 093 

00R000H0B0P|fllOefl0 W0^ 

00O000B088800 > 008 803 

0020201! 820 ?82 020 0fcil 
-'0J 1 020S020^,!^y 10-1 
j'0i:02020E3<'P28?0 IT.-. 
7.PH 1} ZW*Z OZO^: ?tO J >. ;■ 
l •.'VI20203320S0 12t 
5020202020292020 308 
l i0L;i?^CiC;™=O3F?! , «30 1?" 
50^0;-'0DblBlEi , 22t' 1^- 

1B1E22231B1E2229 

lFlF?H2?.ISlE22i*. 

1BT3202020E47F7F 338 
E-4282020I€C?P0r;4 473 
C?iCflt0PaC4C ? C8L;tf 630 

!:0C4CVUPirrjp0r4C:7 £43 
C8CrP0T1320?92020 3BH 
I8E0E0£0E0EHfc.tfE0 6F9 
fc>?e«tt!tyt0tt!iK0Iiy 6F? 
;02028322B202020 11 2 
t08FC?J»020202032 23? 
30D?E3B3ER28a8Z© 33* 
282028285020 20Z0 188 
93202 0ZB 2020 "828 173 
3824202820993018 173 
206 52 02020:3386 20 2RF 
282W202B2020Z0J0 100 
58'202020£8^9?Wfl IF? 
20Z0203220282038 180 
972020202B202020 177 
20202020202020^0 100 
E4 2 H20202B202B 20 1C4 
202020^0i0202P?0 100 
2020202820202020 108 
BC2f20i0f(-riVitUi0 14JI 
7D7fl7E28;0202020 215 
38If9£0E8E8e0E0£0 633 
L0C!Jri?50cO2O?820 34 E 
2834 3638 ;-63#20 28 16C 
2920202020202820 112 
^02fi20?B;03O3lEe IE? 
E32Blf7261ClF2326 200 



100 
10*> 



48 YOUR COMPUTER, MARCH 1 9B5 



he only choice 




#^V 








WTI 






r I 



/ 1 



» £ 



L*«< and the Floaters binary Land 






Driller lank 



• 

1 *■"* 




"•■* 


E F* k . 1 




i ■ "■ ' ■ ■* 








* -\ j 




**.. 


Fire Rescue 



r<7tf 



f&l^ 



s^ 



x/ > 



Hyper Viper 



^TKTLfi 



l lwyi 




33r»V£ I ^Vtl^A 




liLiii: lULUldAl 



SS33E 





„*<• 



ZENAstembt 



■ex WDFRO Kuma FORTH Home Budget 

An outstanding selection horn Kurna's rapidly expanding range of Entertainment 

and Application Software for the MSX Micro-computer. 

'OOK5 Starting with the MSX The MSK Red Book Starting Machine Code with the MSX 
Behind the Screens of the M**X 



ACCESSORIES RS232C Interface 

Speevti Synthesiser Parallel Interface. 

''NEW TITLES Star Avenger Superchess 
Stop the Express Ninja Mean Streets 
.ogo Twrtle-graphics. 

Now available from larger branches of l^J 

and selected branches of Co-op , Granada, 
id *> 



J{*wvMer«BS 




Kume Computers Ltd.. Unit 12, Honeihoa Park, 
llorssihoo Flood, fangbautnv, Bur k» RGB 7JWI 



Hesse tout tuittttofogje en ItiSX prooucts. 



MaTin ... 
Address 



llfrNlfrF*»ri<HMIMUi| 



I 
I 



**m'n*i *«i 



dwri a ..._ „ MSX Carrputei. 



*Vii!K>:s wrjrmp '0-CiH £1 r £wr PifigBOLiiine Manu/aetumg uno' 
D*SJ«ijvf.or Csf'fre a*e adnserf Jo oNdto 07J57-433S fitw for an ' 







REWRITE HISTORY 

jjji;m)! 




Aiioctlon strategy gamestrom SSI- ~ 

It last hen is m chance to m tow pu slap*, up as a 
{fsieraJ in a ml btttle Tlw pajes of hitfon reexd ie 
triom^vs aid Mte as Eue&howe:, Mcntgtmer}'. 
Rcmmt] aid ra fcndstedt baffled in Euopt mil Nonh 
Africa. Bat vrift a dear tokiiif strategist 
lite yturstlf in coranaui perhaps lie J. 
hiitonans wouri tieve lad ■ difteieit -* 
stiry tp wile! fV 

U.J. Gild ii (ttfitd to piAtuI fuu u( liie 
best strategy game; byS&ategi? 
Sinnlatki; hnrpdatB): 

HIGHS OF THE DESERT piicl.es the 
British Fores *i Minlpnay aiainst ihs 
migbt :f Rirwzfj ami his Paine; Division 
in tie riasse fourth Ibicm caipaip 
oflHL 

MTTIE F3B. NHM worara <n 
1 lDir'Jw6fe 1944 and Titinsihi 
KM fom aiterapt tc -sracsh Hitla's 
Uantjc Will. 

TJBEKINTHESHOWroBnstnEtsllie $ 
l^endary Battle of the Bake as in 
Dtuiuutt .944 ULtr PiUlsbi livUiuniuf 
Taj Rwds'edt try ine last j amhle Li a 
□spent* t rtenpt h halt T.ivnfawa\ 
advaaring Mid Lots. 



-the world's NoJ wargamecomparry 



Spectnin^rslofis 
a^lobfe soon! 






WbD Kill telle TEttsindvho Die 

vanquishei? 

Oily you hw the 
unrettl 








5SL 



■ 




JM JJ£JUkmKUBfflUaU,QITIJB UI113 

COMBAT 
LEADER 



k 4 



■P 





muti!.!' inu«Mj>i mi 



V 



T HE ULTIMATE IN RMEFIC5K SOFTWARE FOP YOU ON U. GOLD 

U.S. Gold is stocked by all leading computet uiuiiiu mcludjiy : 

BOOTS WHSMITH JOHN MENZIES WILDINGS WGOLWORTH 

OCJLQUI Ft) kfarnatira era bew 
to bran? a US bid Sroddn 

wrilito:CMrt&ifiHc.,Uii! IB, 
Tk Futauy Iwh^uJ feutr, 
Htutsge SEikt, Binsugban ST 4L¥. 
Nejtoi:ffl4&M 





fATEGlC SIMULATIONS INC 



6 



DESIGN 




Here's the chance 
to design the robot 
of your dreams — or 
nightmares. What we 
would tike you to do to 
win a £1.100 Hero Jr or 
Zero II is to send us 
designs for your ideal 
robot. You can submit 
rough sketches, draw- 
ings or fully documented 
designs. Your robot 
could be tor domestic, 
computer, medical or 
industrial use — or any 
other applications you 
can think of. We shall be 
publishing the best of the 
bunch in June. 



RULES 

■The winners of ne competition 
v/iti be the psoplewho, n (he view 
01 the editor, come up with the 
most usefil, orginal or witty 
cesigns for a tow robo:. 

■"The names of Ihe winters will be 
printed ir the Jure issue of Your 
Computer 

■All entries must arrive at tie Your 
Computer offices by the lasi 
working day in March 1985. 

■ Each person may enter the 
competition only Dnce. 

■ Entries tc the competition cannot 
to acknowledged 

■No employees of Business Fress 

International or their relatives may 

enter the competition. 
■The decision of the editor is final 
■No co independence on tho reaUl 

cf the competition will be entered 

into 

■ Businss Press International 
assumes no responsibility or 
liability for any coTiplainto arising 
f'om this comcetitioi. 



PLUS 



Two Maplirrs Zero II 

mini-turtles for the 

runners-up. 




r 



w 



i\ 



; tmmm COMPETITION ; 

I Don't forget to enclose this coupon, or a photoeupy of rt wien you send I 
■ us your robot ces gn. i 

| Your robot's naive . 

I Mama . I 



Address. 



J 



^iOLH COMPUTER. MARCH 1985 51 



Nigel Clark shows you 
how to join the robot 
revolution for as little as 
£10 or as much as 
£1 ,000, 

FQLLUHflTlNCt IN THE bolsters of lie micro 
revolution another branch ofrueh technoktgy if 
prepar.ng to invade the home — pe-sonal 
robot \. 

flute are growing nun' hers of people an 
both tv.des of the A:lamie whs believe hal a 
BBC E should never be seen wiitu tit it* Bugjy 
ot.3eury arm, ihai the best tec for in Apple 

H>. i-> to control Tupn or th;t J ZX-8 1 lit ustkis 
witbotf a Hcmi II. 

It is often said ihat the persona] robot raarVei 
is -it the sinie suge as (he persona! conputcr 
market was nix yeus ago. It wotld be a 
mistake, however, nm-vuii* tUut ii will Cblkw 
:he same growth padt, 

Computers arc a relatively recent develop- 
ment £iid people heve had litlc time lo gel 
fixed ideas ab?ui ho* they should look and «f 
tvlut they should be capiUc. RmI*jis li.ive 
existed in people'* uaaglnatfpiu for centuries as 
.luniatuidn who ran do all these menial tasks 
at Aould father not iin, Anything thai docs not 
meet ihose requirement) is seen as a Mure. 

1 wo American, compan irs tried to nieiel llie 
tpedficaticns halfway. Androhoi buih Fttpo 
which was imported into Britain fur a shcrt 
tirrw by Prism MicroprbductSj costing 
£1,M9.95, jnd RB Robots built the RK?X. 

B.itii wtre c.ip.ible of movement uiid vjifech 
and the RB5X wis anle to detect iib.stJides and 
ivo:d nerr. Both companies hsvc tad to Jpplv 
lor the Anterwin version of receivership. 

iiericncc has not dei;rn.d them 
though. Beth ire still tiuJing, j-ijJ Audiuboi his 
released another uibtH and mother niarccom- 
|*1l-\ versiiin of ToptJ i* due s<xm. 

And one American company has been quite 
successful. Heatlikit makes Hero I aid Hero 
Ii jiiJ Ipui.i .hi: sij-IU in Br nam, in kit form In 





TAKE M 



Maplin Ekcttonic Supplies and ready bull in 
iforiih Data System*. 

J'eathkh Followed a difTcrcr.t course <o tie 
.hIkis by emphasising the educational aspects 
,il Her*) rather than he Am rooot image .>l tie 
Jthers. Costing about £,,G0O rrr ki and £2,500 
■iMdy-buill, Hern provides n single urns and 

»ingte *htd driving system and the ibility ict 
control these in response tc its five senses. 

Hero Jr was launched cowirdf the end ol 
ast ve;r, It is being ink as a companion robot 
.vhidt iarl speak, Sltw, iwiff poetry- a id ^usi'd 

the house- All this comes rot a price of £1,100. 
While America was folowmg thi highly 
expensive persona robot route British 
developers saw a dilfcreni vay — one that has 
prnywl mm* tucretitul and given us a world 
lead 



Robots as computer p^nr/hcr-als car. add a 
fvrih;r dimension to exxupjier-baflxl cdnca- 
lien. I riMc-ad of wrung a progratr, and only 
B«ein^ the rwu.13 displayed on the *cru.i: ii im- 
possible miv to sec til.- physical effects by way 
of an arm or turtle. 

Courses on robotics 

Ami torn: in o vniicty of Ibrnis <tnJ com- 
plexities. As n gooc guide it is usually the case 
that yttu get whal y.tti pay for, btt it is posabte 
to get so tip quie aapbJstoied equipotni at a 
reatively low price. 

1 he Btatty Ami ."rum Com mti lion cosrs only 
£39.95 for vhich you get thiee ixei of move- 
ment and a hook ftr picking up things. At the 
oner eni of the per&onil robit wale al"nut 
i\2m vdlJ hu; i lie Open UnuerJity Rcboi 
rnad.« by Ti-.-Qtiiprienr 

U is being used hv the Open University as 



the batsij for WO courses in robotics and had to 
m*a an exiKtlngspedikadon. h tn<. tU axes, a 
grippetj Li.n liJt Ikg :-iilI is, said to be accurate to 
1mm, In herveen ihere are a Browing nuintcr 
and variety of arms. 

Alihuugj] the uses to which arms ecu be put 
«rc the slinc, :hcrc u.q Liilotiu wdys m wlri.h 
he -iLinif efFec can he achieved The tnoK axes 
■in arm has the more complicated noviments it 
can pei form. 

The lleasiy Ami can unl> ro ate its base and 
jjutt: die two Hcciipng of rhr arm up and down. 
The TccQuipment MA200U can also do dial as 
A-ell fls havmfl a wris on ihe itnpper which can 
'otate, pitch and yaw. 

F ve axes aie iriori usliliI. htwever, wiih tic 
,vihl yul) I Hiving ilic uLuEiiv to rotate ind moVt 
•ip mil down — examples ar« the Armdroid 
ton Coir*: Robotics, the Genesi:- scrks frtim 
Poweriran Cybernetics ind the Alas from LJ 
Electronics. 

Therr arc nlmQst 20 m\i* o.i rhe i mikei ill 

Britain, the rnaiority ol which are Britidi 




52 VOUf COMPUTER. VIARCt- 1965 



"Do the washing up, hit the kids, 
Strangle the cat" — that's the sort of 
robot promised by must or the 
automaton manufacturers riding on 
the back of the micro boom 
according to Jon Barron of 
McAndroids 

When he Isn't makfiiy parts for i>kJ 
Har ey Davidsons or inventing special 
effects for film and TV like a ten foot 
treadmill for a Bronski Beat video, 
Jon builds androids like Ihe one on 
trie left. Togslher with sculptors Alan 
Dun and Richard Glassborow and an 
electronics engineer, Jon's been In 
the Me Androids business for a /ear. 

The first McAndroid is 5ft 7in tall 
bmjaustt "a very big figure '3 threaten- 
ing" and :he Ms As are trying to make 
robots friendly. The androids are built 
out of glass fibre and chromed epoxy 
resin joints, powered by model 
aircraft servo motors connected to a 
new patented valve design, and con- 
trolled by aZilog controller board. 

The McAndroics are way beyond 
the pnce bracket of even expensive 
rubolii like Ihe Htiros but the Ideas 
thai the team are working on now 
could be used for cheap units which 
would plug into a home computer. At 
times Alan is amazed at how slow the 
uuLsiUu wuihi has been in catching 
up with cevalopments in robotics — 
Yellow Pages still refuses to opsn up 
a category for robots "it took them 
seven years to get rourd lo videos". 



development*. 

Movement is usualb prov.di.-d by siepper 
motors 01 4crvo] and can be controlled by a 

variety of micros with the B3C B being he 
most papular. 

"."he area in which they tend to differ is in he 
drive medtanisms. Most use a transmits en 
aystcrr to take the power From the motor to :hc 
joini with varying decrees of viphistication. 
The Afmirttdj resting about i'SOO, uses n^n- 
strttch nylon cords, the Atlas, at £1,950. has a 
tocthed belt arid the latest machine from 
Cybernet, co Applications, N±ptunc, £1,2^0, 
lists hydraul'.CS PneutratU systems are being 
assessed by other companies. 

Accuracy and cost are tbe two factors lo be 
taken into account when deciding on the trans- 
mission *y«cm Hydraulic and pneurrutk 
systems a _ e usually more accurate th«i cord or 
belt Systems rtul iIilv are tlsn mure expensive. 
LJ Electronics however has achieved a h>gh 
degree of accuracy ■with the belts on its Atlis, 

All ihc manutactircrj ace cduution a-* their 
majur markci w ill small, light industrial uses 
coming second ind heme sales a pjor third. 
This is probably dje io the lack of software. 
What is ava.hWe .s ism-liy- concerned with 
purring the .urns thiotith their pates and sinur 
tating the larger arms to be found o> the pro- 
duction lines 

Cyber Roxitcs has hunched ; package 
which illustrates dw. Most oft he programs for 
the Cvbc* 3.Q timaliKd other iypt* ol" .lull, 
iih.iaugh i did contain a piogiam which solved, 
the Towers of Hanoi pilule. 

h is a market which is profitable for mjny 
smalt cotr.panies and there i* a growing number 
offhem jeekmgto :ntsi-. 



Whereas arms are mainly used as smaller 
vers.onf of industrial equipment, turtles were 
developed to expand children's ibiEty to l:arn. 
They li"l- kistd on the lliturk-s. nf Seymour 
Fapert, who wrote Logo as i high level educa- 
l.onal hneuage. One of its capabilities was to 
allow iiii]drcT\ Lsiilg simple commmds, u> 
control a chancier on ttic icr«n kriewn as ,i 
tittle. 

From thft were developed pehpherds calls! 
Utiles whi:h wen: mobile devices wth % pen 
attachec w.iieh could draw designs under the 
control of the compoutcr. They wc _ u: simi'Vir to 
plotters bu: w;th far greater freedom of mov;' 
cum. 

(cvnthuetf en page 55} 




riero — see pag*5t. 




Meet the Gang! 




ST EVER MULTI-ROLE ARCADE ADVENTURE 

Includes Hit Single on reverse "Everyone s A Wally" performed by Mike Berry 



Spectrum 48K £9.95 

ComrrodoreG4£9.9G 

Available Shortly on Amstrad CPC 464 



[ 




44 The Broadway. Bracknell, Berks. 0344 427317 



(CQtH i-)ued ttotu pay* 53) 

There ire four British turtles on the market 
wi-h rhe sdd tim o""the Penman plotter which 
is designed similar Id ;i urlle and can be ased as 
tins. 

The msst traditional 15 the Jessop 01 hdin- 
burgh turtle. Looking like an upturned mixing 
bowl x'ith two drive wheals ind a pen holder 
inside it closely resembles the original design. 
It can he comrottec from mo»! iT ihc popular 
micro* v» an umbilical ccrd, 

Hebot [1 from Powenran it, :i sim lar design 
but only available in kit. The mast famous at 
the moment is probably the BliC Hu.?gy due to 
its appearances 011 television in the scries 
Making the Mont of the Mvtq, Like Hebot it is 
less to do with the encouraging of different 

forme of education then with luichin^ pu^pk 
abum computer eiintrol and robotic sensing. 

Valiant Designs has gone for the same Papert 
route as the Jestop and the company's Valiant 
can be controlled by the various dialects of 
Lc go vvli-di art av: ilabtc for :he 115 ml micros. 

It is tic only one which has xa deigned to 
look Like j tunic although it has the same basic 
rwp-whed drive an J rctrafrtjk mi holder of 
l he otJlcn. 

Littte applications software 

It if expected that these v,ill be pined by 
oihci veisiuns bia l.ii* year. I he £eafcer, 
which worked villi a ZX-81 and wis sold by 
CnW Rehatirs, is bein^ redesigned by IGR 
and sltou.d be on wait stum. From the "Jnited 
States there is news that Andiobot has fin illy 
go: bred mm procuction and lookmg at the 
possibility of sending some tc Britain. 

In fnnmim with the irir.s there 11 little 
applications software available for ue turtles. 
One cf tbe exci:ing prospects Tor 1 ?85 is the 
launch ot 1 rtkker and a suite of 30 programs. 
It las been developed by a secondary school in 

N*rth Walei and ,s teinft produced in con- 
junction with the ITV program, Th* Mhv at 
Wark. The software covers c w.iole range of 
applications in maths and robotics. 
One area that has tot as yet concerned British 

mi.nufaciu.reis is toys. Thai hvs been, left to (be 
Japanese and Americans. They have not pro- 
duced anything which is very complicated but 
they arc cheap and have some apprewmajiun in 
robots. 

One: of rhe first was the Big Trait from 
M Hon Bradley. It is 1 large tank-like vehicle 
which has a keypad on its lop which is used lo 
give cLrectioris and emu £.50. A similar product 



Neptune's Nonh Sea 




Gemmation's 


■ r ers3tite Beast y. 


r ' 1 




F f I 






■ "^^^Jw 


j 


r^B 


K*3BMh 



uva<t larnrni'd last year. It is caliec G^or^e the 
Comporobot tod costs ;ust under £2>, 

Tomy Toys aimed fos the Christmas market 
with the launch or ihrce new robots in 
November- They have been produc ng a uy 

irir, fhr Armatton for -some time and now 
have (he Dingbat at £5,)9, ihc Vcrhot at 
£39.95 and the Omnibot at £149.95 

I he success of last year though vas probatly 
■he Mcvits, Imported Fiona Japan thty ranged 
n prirr from jfOQQ fo £34 99. The m«r 
expensive was a simple turtle when could be 
programmed using a small controller. There 
are now interlaces available which illow it to be 
connected in 3 Spectrum. A further tobct, the 
Wherdj has recently been added 10 the range, 

There is undoubtedly a great deal cf interest 
.n rohrlH. They can be pirranieed tC attract 3 
crowd wherever ihey go and a number of com- 
panies use then in promotional wCrk. Thrjy s;rc 
onlv radio-cent rolkd nioiels Jiui ifny' ii' 

people's views of what robots should look likcj 
/iews which have been condit,oned by Jlctijn 
such at Star Wars or the HitcUuken GW<fe in 
:he Galaxy. 

Thor e viesw^: ait being further developed by 
people such as Jim Whiting whose wunderru] 
mobile jiCTilpttsrci, controlled by a Spectrun, 
ncvuT lail n astonish large ntmbeTS of people. 




ReaJhy .s rnor* mundane, The arms turtles 
and toys repre«cn' the limits of what can b; 
achieved in personal robotf at the nomeni. 
While they periorm a uselul tjiiction, prn- 
eularly in eJucaticn, they fall ftr short of th: 
expeetation» of ihc gtneril pibllc. 

There are problems in meetin* these cxpcci- 
atkms which are con;cmed with mfbrmition 
guhtriti^ and processing. Walking tcrott j 
rooir, avoiding obstacles such as tables and 
chairs it beyond the .-apjbili ti» of any rabot 
whici ct uld be produced at a co*t whic'i wjuld 
ir.akc il lttr*ctive (01 use in the home. 

The robot nexls to have senses such as touch 
or sight to loctte the obstacles ind ihen inic - 
li^eii.^e w reuci in nich a *ay (hat it m.-ilcesprc 
gress across tha room. A farly simple devics 
could av^id the obstacles but would react l.ke a 
pinbill macliiiit withoui any guarantee that it 
w*0uld rcyeh ils gml. 

The Robat competition 

To help il decide wliieli wiy TO mm it 
woti'd need to store in memory the overall 
direction in vhich .t should bu going und 
detailed description cf all the obstacles it may 
ineei on the way. Fiu cxstnp'^ if it :arne across 
the settee it wouic need to know vherc it had 
hit trie settee ty compauig the infoinatiim il 
could gather with that in ill memory ;o it 

vfouid know to aher course 10 ensure gdiing 
round the settee ir, th; sinplesi way. Anything 
more cempiex and a huge memory vroukl be 
needed with some form cf artificial intelligence 
to sett through it. 

There is no lack of ecthvsiaf m for tackling 
these d.ffKulties, Jo.in Billin^sley of Potte- 
mouth Poryicchiiic, who begjn the micro- 
raome contestSj has now launched a new 
problerr the Robat competition, The o.m ,;. 
TO Cieatc a maehiae which can play a form of 
robot l able tennis. 

There has been a huge cmount of interest 
throughout the world aud prototypes are 
already taking shape. Solutions found in this 
cjnlcst *night provide th: basis for more zom- 
raerriol aprUcations later. K 

v OUR COMPUTER. MARCH 196S S5 




Every computer needs 

CHATTERBOX ft 



_ ^r— ^ l"Lisieo creep 



SPECTRUM ^i^i 
SBC 

APPLE 
NASCOW 
VIC PET *4 
(Please stale i 



NEW! 



EXCLUSIVE 




PITCH 
CONTROL 



/v 



CHATTERBOX II can sey anything' 
Genuine phoneme synthesis ■ notjusl recorded 
sjj^^uh - hence unhmiteo vocabulary 
Pfog' a mutable pitch foe mors natural intonation 
(excljswe :o Wm Sluart .Systems)- sniiritone 
csbinel for quality sound - irregral beep music 
amplifier PLUS expansion soc<et foi BIG EARS 
voice recogniiion system, Full instructions 
technical notes and software supplied with this 
outstanding educational unit. 
DEA_E=IENOURIES WELCOME 



As awn on SBC TV "Computer Pog-ammc 

* BIG EARS * 

SPEECH 
INPUT 
FOR ANY 
COMPUTER 

coTiplgEe wtlhmieropnore sohuare anj 'u ' 

irtHrucuorvs 

BUILl ItbltU t (jJAHANIfctD 

PLEASE STATE CO VIPUTER UK101. 

SPECTRUM. ATOM NASCOM2 Vic t> Micron 

rHiOiii w iKSftu mita*. trm ». mt m(t*a cw n 




onlv£49 



ZX81 SPECTRUM ^ 

MUSICSYNTHESESERlStereo) 

i 16 LNt CONTROL PORT W 

Play 3-parifln>s<c sojrsdeHeds dnimselc Fun 
contro of allack.. decay aid (fequetxy 
Input Outpul Ines provide conrrci a^drronii&r 
facility !or Home Security, Hobo! Conlrc<. Mode 
Rali*ay et etc Wor^s vnin 3' A»lhcut 16KRAM 



NEW! 



VIBRA'O 
CONTPOL 



Fu I »n$lf LJtl.OnS S^Hwar? tOCiuded 

Add htyOfrrt'dto nak; a hve perbrrrance 

poyononic syftintsise'' 

Nol* up to 3 units can r>e used s^ulaoeousiy 

giving 9 nvjste eh anneis A 4fl I fcrws 



AMA2IMC VAUJE 
AT ONLY 

El 9.50 (WT, 
£25 50 flUl.T) 



THE COMPOSER 

Syillfinwr Mu$j. 

1 1 Hi k fli*y i pal ^'fl: —nr% 



■'. 



TALKING HANGMAN 

Fo'C | uit«*b9i 

nwciasit: yr-iE 

i i.l 'i-. m Kilns / jJsVi-l 

jci iiti(3a( ihcil iV..>. . ji Cb 



ZX ARP'DRUMSEQ f — ■ CHROM AGO DE ?????* 



WHXiiKii-vts G*i*"at#i 

p)WI Iqm *tr&oifC Son* 
wnj fhcbtSixcliiri} 



Cir.you lelulf- Inn BOCbDr 
CfMongM aet'B 
tantunJUH"- teraif lime <i.r*> 
jjgl" Witr ChilLeitDH vfi.r.ft 
OulfJl 4S|»CI'U»i) ES 



COLOUR MODULATOR 

HGB in PAi UI-f OM1 (notloi ZX. 



-,-£16 

bliltE22 



PlftAUt sclrl 4/ AT al 1 tt tn prtfflfi. 

Bfli day .'Access orders accepted by telephone 



ill ?nquin»s 
3.AE, please 



WILLIAM 
STUART 

SYSTEMS Ltd 



QLane* Down Holts* 
CrcwMnon 
Ht S««t>uy 
MM* SP+ODZ 
Tel 093064 2* 



SPECTRUM 



RAINBOW COPIA 

♦ QUITE SIMPLV THE BEST BACK-UP CO=IEP EVER FOR THE 
GlNCLAR 6 3 ECTRUM 

♦ ALMOST AN^" PFOG1AM iSFtePRQOUCEDON BLANK TAPES 

♦ TESTED ON OVER TOO TOP GAWES WITH A 9B% SUCCESS 
RATE 

tMJLIIKLt h"AHI ^m.'U HA MS U^ClC:U UP IY OTJE 30 

♦ ALSO BACKS-UP HEADER LESS PROGFAMS 

♦ FULL INS-RUCTIONS WITH THI3 EASY TO US: PROGRAM 

*THiS ivn"ftfriiBi.f machine code program s excellent 

VALUE # CS.95 Inel. PftP 



COMMODORE 64 

BRING YOUR 64 TO LIFE WITH. 

LIGHTNING LOAD 

♦ CONVERTS ALMOST AL. YOUF FAVOURITE SOFTWARE & 
GAMES INOT A SUPFRFAST LOADING VERSION 

♦ VOLFR CASSETTE PROGRAMS WILL INDEPENDENTLY LOAD 
f ASTER TH^N THE CCMWODDRt DISC OfilVfn 

♦ LIGHTNING LOAD HAS SOPHISTICATED FEATURES WHICH 
LEAVE OUR COMPFTITORS LIGHT YEARS BEHIND 

♦ COLOUR t SOUND ARE USED IM SPECTACULAR t, UHIUUE 
WA ¥ S TO ENHANCE THE PROGRAM 

♦ 100% MACHINE COOE, FLEXIBLE MfNJ SYSTEM ALLOWS 
SAVING OF MCRE THAN 48K CONTINUOUS RAM 

♦ I HIS AMAZIHti KHUbHflM lb NJW UN ^PliOIAL t-FFER E7.9& 
NOW E6.a5inrf. PJ.P 



COPYCAT 



THE ULTIMATE BACK-UP TAPE COPIER 

i MAKES QACK-Ur COniCi Or ALMOST ALL SOFTWARE 

♦ SPECTACULAR MULTICOLOURED UOAD AMD SAVE 

♦ WIZARD AUDIO SOL NO EFFECTS 

♦ CASSETTE MAGC SENSE 

+ 100% MACHINE COOf TAPt COPlEFt WITH FULL WSTRU-TIOWS 

♦ CAN YOU FIND A BETTER COPTtR' - WE 3AH*T! 

♦ SUPERB VALUE AT £5 95 inc FSP 

DISFATCH OF THESE PROFESSlOWAL PB'SGftAME WlTUN 34 

HOURS! 

CHEOUESi'P.O.'s TO: 

WIZARD SOFTWARE (Dept. YC| 

59 THE MAPLES, EXMOl/TH, DEVON EXS 4ME 



HIRE SPECTRUM 
SOFTWARE 



OVER 2B0 flillc r enl tapes lor hire in- 
ilui.Jii.) ARC\D(. ADVENTURE. 3US- 
(NESS. EDUCATIONAL i\z -.?vcn n m.-f 

CfETVriilnr FREE ?R pifjpi-flliilGQja FREE 
ne-vslJUe'. ftilh hints, tips aeiL our top 
lapti 'J'-.-r. 

OVER 3000 jipe-i in stock, with up lu 60 
cooief ol each t tie for last SBTria, All 
[apes sent b) 1st class pos. 
LOWEST PRICES - h re Lp Ic 3 hpes at i 
tne. fcwn 63p eich loi I wo weeks hire. 
(Plus 3&p arvrj VAT). Firnpaan inwubers 
wefcone 

Tape j for silt it DISCOUNT print, 
Tr nphonc 01 -6G1 9240 (9am - 3pm) o 
wnle ! dt lurthei jeiflls. or coin)lel3 "he 
cojpon and JOIN TDDAlf-yQiVe nothing 
to lose' 



SAVE £3.00!! 



For a Imiied penal *e 
are oltaing HALF-PRICE 
membership ;c leaders .il 
I his maga^ne. Join now. 

LIFE i iibri i iLjm :22 1 1 LJ i: uny 

£100 (normally EfiDO). 



SWOP SHOP 



A nuw s;ivite from N,S,L 
SWOP your unwinie] 
tape; with 1afa$ fron 
oihei-iiwiterstoTasinai 

hanc ing Dharge of onlv 

sop (plus nip ano vat) 



HATIIOIIM SOFTVKME LIBMIiY 

'IJHfirelteld Avenue. ClTiBam.SuirflySM? 7NE. 

Unclose chequeyposal arderf or £3 00 f op LIFE me mbe rship . Please rush 
my membership tii lc rrw. II. *rtrin 36 (Uys, I'm nol delighle^ wilh vput 
SMVice ycul 'efuid nty rrcmbOfShip ?b.. 



Nmnc. 



Addrees 



¥33 



£6 YOUR CCMPJTER, MARCH 19ft& 



A MllEND or MINE liad an Or.t program in the 

Sijpicmbjr issue of Your G&mp&er. I have in- 
vented a similar game frr "he XX-81 I5K. 
You move Matl on platforms and try to jump 
up to ihe top oT the screen tut watch toil for 
tliE iiiuusLcr*. IT yuu arc on the second plat' 
form and fa, I down to the first platform jfOW 
will die. Ytu smrc 10 points every time you 
jump andj if you reach the mp, 500 points in 
be mis, 

Now, to CDtet the program, first s-t Rarniop 
10 26 36 8 by typing: 

POKE 16389.103 N/L 

NEW N/L 

Nnw ra:ikc a }4fj bytes long Rem stated'. mi 
bj nuking iiiic 1 tq 10. &9 dlttittttciis TLitrn 
Poke as direct corr.maitds: 
POKE 16514,1 1B 
POKE 16515,113 
POKE 16511,178 
POKF 16512,3 
POKE 16510,0 

You \fci]l tii>w have jr. empty Rem state- 
BKD.L Now enter fX hexJoacer m listing l . If 
you don't want to set line I) every time you 
enter a line yOL Can tvpe: 
LIST1 
POKE 16419,1 

Run Uit: Utiluidci and Lypt in nil ihe 
mich.necodt id listing 2, When That is ready, 
delete ths hex loader and ent:r the Basic pro- 
gram in listing 3, When you have done 'hat 
save the program by typing: GOTO 450 ■ 




Listing 1, 

? ci'i hc*loh:ef 

10 PBIM" 'STSBT R&DfSESS" 

£tJ INPU : 

io p-nr ft ,;=h ^r-CRe:-;. 1 

SB FOP H-= T' F *>TFP ffl 

BO LET -=c 

~a PP.IN - K; "; "; 
30 INPU - n* 
jug pSlN - FSJ ' = " 
Itffl INPU - TOT 

lie prin - tit 

IIS IF PEEr lfi4S2*2 THE.* SC&3LL 



120 LET 2=0 

lzo f:.= m-i tg leu «$ rep i 
lag Lrr c = 'COOE ph.m -sas+ie+co 

DE fl* (-.+!) -2S 
ISO L3T T-T+C 
ISO P3KE N+2.C 

170 Lrr z*z+i 

i9a i= tgt^t t^h eoro aaa 

= 06 !=- INT "ERROR - K.c-.rE lunj- 

R0RIN" 

aes s- pee* i6+*g*a rnem iinou. 

210 GjT-j 63 
£30 NEVT H 



Listirg £ 

3 LET -AM"ZXei a 

s let l=s 

10 PRINT T^6 ifl "HflDJUHF II' 
20 PRINT AT £1,3; "HfiCE BY FPEP 
R.2K t'.-PRSeHN" 

25 gosub aaa 

3B PRINT OT £.0 "! 
-EFT" 

4.0 PRINT 'B TO £ ! 

3U HWiNI I li. ill 

&0 PRINT 

70 PRINT 
RT THE GRME' 

ee if jwKE-i" 

3S CLS 

90 RflND 'JSP 173&3 
100 PRIKT TAB 10"rtflDJUM= II" 
t&R PRINT ST il , S. . "MfltB IV FPFT 
S1K IVflRSSON' 
103 PRJMT RT X . B. 
110 PRINT 

115 IF L»l THEN &0TQ 310 
ii& PAINT '_IL£3 " ,L-J 



TO U MOVE 

nOUE RICH - " 

„UP1P 



PRESS ANt r.EY TO S - fl 



THEH COTO «<3 



tJM 

-.- -Fr 

lit 

17C 
NUE T 

13C 
IS? 
19C 

aic 

S3* +4 

*&*; 

£51 
E " ;H 

ass 

flOflIN 

2bf 
270 
000 




3 IM- 
PRINT ' SC 

EH 165S9 
■H+liNl 
LET L=L-1 
PRINT ' PR 
ME OPINE " 
IF 1TJK.EVS 
CiS 
RflND L3R 

soto ioe 

PfilWT 'PL 

PAINT 
PRINT .0 
5&+PCEI- 1 

Ft :nt 
ijOous .'a 

PRINT PC, 

I 

PftlNT 
PRJ'JT 



- _ _ 

_ - b. 



PBW iSE£2*£ 



■f: R KSt 1 TC COtJ - ! 
- " THEI4 COTO lftO 

. LIUE5 : n«T" 

J SCOftBO. ".PEEK IS 

^s£9 

■ Hflye THe hi-scps 



PQ 'CV UflNT TO l»Lfl. 

IF INKEv**"" THEN GOTO 250 
IF JHKEYl*"Y" "MEN ooTi A 

IF INK£V(<. .»"K ■' THEN GOFO ££ 



■Uta LLi 

2S5 STOP 

523 FFINT ftt Sj.Sj "INPUT 5FEEC 1 

fasti -iee iSloD) ■ 

33B INPUT S 

340 IF S<1 OP £>100 "MEN fiQTO 3 
30 

3f» rOr.E 17337,6 

350 FOKE I7£54,aBfl-*) 

354 POKE 171fiS„2eOS5 

355 FRItlT AT fl ( >; "" 

■ ■ . py J fl . 

3&B FETlfPN 

370 if peeh. issae+iss*pEEt< iisa 

9( =MI THIN PETURM 

3SO FRIhiT Th^.H '.Ell lag Wife 

39B lei ni"ftthi itsg!j+3DB+plTPT 

-6539 

395 PRJMT 

a 00 FRIKT -yiiflT IE VOUR NflMe?" 

4 1A INPl/T m* 

AgO JF LEN Pit: 10 THEM GOTO 410 

408 FRIMT RT fl.B, 

4*e PETUPN 

ASS ;RUE "Mflf-.nilP TB" 

+se euN 



itSl*! ^S"^630O£020il£iei = £40 16a*6 : 

lSSfiE: Ciee4.31C77R4fll4Ci0 ■ *£6 16S24.; 

i^ssc: 2Eei3£5F4e£ieeeo = es'3 icaas 

16533: i£OB*0CC-6E4iacrO4i - 9Ci 100C0 . 

2654.6 iS213B7C-OS£03694 r A70 160E3 ■ 

16SEA; 2210=BO5£BC5CtfiD * tJ5 169€6 : 

i6S&£: 4HC»"5SBFSai6I'7B = S4G 15674. 

1£573: 24Se4.eC Dfl*J4.4P»£Ofl - 94- 1CQCS 

16573: CECDRDilC3C-L43CD = lSlfl 16850 

16580: FEiaaflSC^eilSOQl m 7£6 ie?^-r 

16531' iS-E^ElliflSDieaB = ?£l l*9^c 

16402 ocrcirC'jeeoecooe - oso icsia 

16?1S: ilCDSiiJOaeOOOSR ■ 5€3 169c£: 

16613 3Ci03P254eFFBF2S ~ £43 14910 

I66S6. eFFE"?F2SSflFEFE2S * 1E69- 169:3: 

1GC54 CS10ClC--Fe*£llC3 s 1*SS 14946 

1S542: ee37EC'5£CDRD48E3 - 1E4-5 16954 

16650: CCP,D41CC-P14SE1CD = 1177 169t£ 

16&S3 CRA3112S0037EDS2 s fVS£ 16970. 

isac6 TcrEia-cooBoaijap = 74s I49"d 

16074 ei37CC-FS43FE67Se = S££ 1&9SS 

16652: i7E5SHi9e40iLF4Ol = 7Ei 1&3S4 

16030 i?^230-^ElSfi6£43 3 729 1-003 

isfl^o ■5C3DC.C'C;*aC3se'4o- = ieoi i-bio 

16700' E5£R9eteiiefieQ19 « 531 1^025 

16714: 2£904C£:C3BDJ.OCD = 11£0 170S6 

16732 FfiiaaSTEFECSaOC? - 96-9 17 ;4 

io75B uAreeoTEoeaeecs = ei? i'«4ti 

16733 BC10CD-F3422B7EFE s 1195 170=0. 

it7is csaeesiiaeeei^ee ■ 3ia i-oes 

167E4 CSBD403fi34*BE61P = 0S3 17flee 

ic ,'cfi 4'.'iortuji;aouiJi*iJt' ■ y4i l'a.'i- 

10770 21©B70BFfiF571936 = 6CS l"0Sa : 

16778 lTC3CrE0i31LPD01 » 911 17063 

1675S 15E l 5CC'ft5iSCC'2£'14 = 1003 1^053 

14794 C3164.4ClC0Cfl4Jll = llfildx l" f ie6 

1&303 C609197EFE1FCBC3 = 1029 1'114 

16310 CE*40eftF32eM:4oai = 535 i-iee 



7*6-3116 4* OB6 1 r 7E 

2B772323iereafllP 

FEOOaS0A3DiaiSE4 
7EFE14.£3073E0£3c 

l:4iiobsjcb33sb;i 
413P3410E602C60C 
127EFEU2ae*36la 
13Oa3BP4017P0^3P 

0C4.arcoi£eootJi74 

0;'0O137BFESCCf3P 
BC*eiF3F173eOC4.e 
FE0eCRB741O61F7E 
B07 , 7eB2BieF9fi3C3 

ciiieeooooeeoofrF 
3E0C4.eaiac79e*2E 

7EFE0fl£3052JlOFc 
lSiSCf'rai££e7E2 2 

FcCPsaoceeeeeaos 

0^2&CDC'7^E2318Ee 
ii73»2?0FE©C2i?DC 

i»ul>d f+siey/fcotjc 

15037CFE67C33RSC 
4aiF3Fi73aBC4eil 

750 £FE&e£M3 1171 
e£3-E:^3Fev3tfcan= 

062O7EFE0R23O5aE 
10F31SC--6CDF84S23 

7eFEC9£30See0O0c 

1 17202 L9CDD743 11 
71O£37ED5E13C-30^ 

oeiigflis^EFseaee 

IK/ *lJI,bU12I0O0s 
::l^F5Fl(3l8fl0iF£ 
0fli*01?E30O53-Er; 

4££-£:8r>A.iac9eoaoBc 

OJt)iOUOeOL)0D=-C57E 

a*ee0eeai50iifl64" 

O6OC1R7713C50121 



3ftT 
586 
4S7 
561 
641 
071 
506 
4.03 
611 
BflS 
575 
B67 
733 
433 
453 
734 
fa t 
507 
BIS 
7S6 
91E 
1114 

4sa 

E36 

C!i4 

510 

Li 1 .^' 

779 
661 

404 
1057 

5E8 

so.; 
536 

2S0 
413 



iriSe 

1/lLrB 

J7146 

17154 

i7162 

1 ^170 

171-0 

i - ] ■ f. 

17191 

1/UVU 

172-0 

17318 

172£6 

17S34 

17242 

17253 

17253 

17266- 

17274: 

17262; 

17290- 

17248: 

17330- 

17314. 

17322: 

17330' 

17333: 

17346: 

17334 

17362 

17375: 

1 ?-*** 

17394 

17402: 

17*10: 

1741S' 

17426 ■ 

17*34: 

17442: 



eoesciiorsGisee: s 004 

J- , tL'4ii-ll'lUyL:31i = 1L75 

2ieaee3^56i4i9i0 ■ 1&6 

FB116B3137EDSSC1 « 9^5 
C9ee06337SE047CE * 103£ 

cD6343;i.eF6aeeo - §11 
eoeeeeaeceeaepsF * 3*5 

43C90O3Oi.lDFESll = 7^1 

= ie0F^3£FE06OSlC. = S7g 

-tOeLOil'.'0L'3FFlS « 2SOC 

'1D4E43D5C23543CC- = T 4 

Bae2CD2ee20O2Lae . B'g 

*3C30A3E:eocoeeec = aoa 

3RSF4 0:-:-.'2cF4eFE = SS7 
FFCe&lf767C0074« = liec 
3P344e»6C73e8P4C = 360 

090000302 leeoTee - 351 

CU06£0 3414E3ieFE = 0O'l. 

36C9233D20F3C9BC - 7'9 

eO003E3OE0i7D&21 s 024 

E643C930O03E1EEC = S3F- 

4^DO2131l32C90B0B = 6?- 

15illil3949E9E9E = 698 

0ftlEAE30Ofl*4OE«£ ■ 541 

95941F34OP1E1E0E = 551 

ElDlC3aC4,33DSiSl ■ 775 

C506FFieFEC115FS = 1 L85 

C9CDB54332S643C« =. 1077 

C&B3433DFS42r:Qi7n = 1351 

21*22R3C'i07£Fl0f - 738 

C 80000 ; , JC040Cr-'Bc = 104C 

+3CDF842C9C»9a4e ■ 1203 

r.fi0^4^7Q-r,r,Qfn0c; - nae 

OC430C2r>527CFES£ . BB0 

C03E67;9CD52*3CC = 1L17 

-E4lC9:C'flB42113C - 982 

AM47F3AAn.4jBFE17 - fi?e 

C8C3BC-40£5ilE70e - 1L2E 

7EFE0R=lC0C39t'41 = 1832 

CD£142::£-RD41C9Sa = 1076 



YOUR COMPUTER, MARCH 1985 S7 




EIGHT NEW BOOKS FROM INTERFACE 
There's everything you need to be 

dynamic, advanced , intelligent and &t ! 



Tlie Latest books from Interface 
Publications Ltd uredeternincd to 
put iifwr skill's at your programming 
f.ngertips — 

For instance: 

If you're the dynamic type- and 
you own an Amstrad, what could be 
nttef than an r kit cat title 
' DYNAMIC GA U KS FOR THE 
AMSTRAD"? 

On ths w.hcr hand, it your mind 
i^ far in advance of other o»rthlings 
, . . don' l despair. 

■ ADVANCED PKOtiK A M MTNG 

GUIDEntJTHKnnCMl(.KU' , and 
■THE QL MANMJni H-L" will stietch 

your imagination sill Further. 

But where do you turn f you." 
computer is giving you d imb answers? 

look at our "ZXI'L >R1NG ARTIFICIAI- 
INTELLIGENCE" ser.ee 



for the SPECTRUM* and 
Sl J ElTRi:M, heCOMMUlM KK <>4. 
SIM LAiKQLard BBC MICRO. 

The mind will boggle! 

We even, have at ntw book for 
readers who think Hl< 

It s called "THE BIG FAT BDOK 
OP COMPUTER GAMES" - for 
prarl irally my micro. 

AlHhesencw tit If* are Ariiipn 
by the country 'a must respected 
computer author . . Tim Hartnell, 
Clive Gifford und Jeremy Huston. 

So don't despair if other hooks 
have left you feeling lethargic, jaded 
and hungry . . 

. . .go along to your local 
bookshop and le* tl-esp eight o^w 
Interface books give you a 
"piek-itie up". 



See Them at all gouti UuukHlnipH or 

ixtmp u 1 c- r Fttor^ 4 or vrri tp t<r; — 

l liiTiiite Publicadoi-is Lid.tfflfC) 
H-il Kensington 1 liRh Si reel 

London v\> r,NP. 

Nam^: - 

Address 



Please s*rrd me ihr following bcciks: 



I .»fiHnsc remittance in full. 



■ 

I £tater£oce Publications ltd 

"V 



ItifHrhiL.i' 1'J^ici.rinr-. wn. OlitFtbiCiMl rvi 1»mvl[i HitJ'ir UK.in<J Srelgr WHS DtMfbalMft 4) .khn'flHO'UM', Eas Htm, r^rr*ltTHJaU)5fillfK. 

&kp»fi •iriW^linri'lLL.'dhy Iii'i'lnce .'ublratiiiu Jd 



58 YOUR COMPUTER, MA=1CH 19B5 






Terrapin is A maehine-ecnie game for any 
Specirun. ][ features high resolution move 
ment, coIoli graphics, sound eiTccts and u 
high score utile, Ktm, 10 net up the piagram : 
type in the fiiii mathine-cudc luting. The 
rlac.i is carefully cheefcsumm*d so ilim virtual- 
ly any error will bt dtrccied. Ifa length error 
occurs when ycu Run the program, check rht 
letr- and nghL-hLnd ccluians i»! the line 
concerned. 

The e.TOf will be between I he li*l currccl 

number — or letter —and the first wrofig one. 
Ir. the case of a checksum erior The position is 

more vague bu', generally, ihe farter the dif 
teren:e the further along the Liue i. is. Theft 

issdvmys tlir ppssihilitv ihai vmi hjive t7p4?i ir 
the checksum vronglj — this is in ihc first sis 
digit?. When this ne^ piogram runs wilhoul 
errors, save it — fusl in cihi: — and type New. 

The program \rill disappear but not. the code. 

Run completed version 

En:er :he secanc pngnm anc Run it in tbe 
same wpvj thcr. save it. '.'ypc Hew again mad 
enter Kh< >hortti Basil, listing. The whnlc pro- 
gram out now be saved by Rur 9000, It wil. 
almost certainly be errot-frte because of the 
checksum. 

Ynu c«n row Run the completed version, It 

you switched off at any time bc-twccn typing. 

La-ad .uid Run the machine-code lisit.ng* 

(continued on next p*ge} 




Tired of Ken 

Livingstone's newt? Now try ten Collier's ." 

TERRAPIN 



Program f. 

IB DOTP "241<?24&2ldlddif7a09?42 
B033032 15 15d51<<»000i 00007b J/lI:. 27 

7dl7e3lt01e0B7,Sfl7i4527 r 7?8tiJC0-dc 
577S73. B Qac:cJ167a3edd7 7i07*l 101914 

5a* 92574 e4f2BPM iff 

20 DA'fi ,, 2 , ?7A23fl0:G0efe002'03aj 
F *7-5f f cO 1 2SB3 1 1 B0* * + 1 cd?3 7730:1* * 
5dd7el03d28 lC*37&=»d44ba2B0679ed4 
4 bb 28084 1 3d 3d f e* a30B8*5f I d d 77 1 04 
I10bcrid5clc:34.477 = 5* 

30 DA~A "22328547e52&01@el5+&*7 
ee 1 f da&3eb83803901 84 ac 1 e9e5d5=5+ 
Dutl 4b 4 2Sb06002 J La33Cd3d7i.2«24ad4 
b405bcd5d7a3e3Od7^4^4ed4b4ftbb36O 
0cd5d7a3e06d?2t24ed * 

*lfl 1)H H ' n 1 L5Jt)SHtD4ia)BoUli)ei5e. 

&d77cd77dd7ed:2t.2dcde32det7c*e0br. 
0f J c 1 d 1 e 1 e9005 f 003 I 4B5f 000 I GBr.4 
Hti 1 4 Ha f 1 00 4 BB4 1 004 4 00000 000000 
fJH 000000000000 B« 000" 

SB DA~A " 'U0000000000B000B0000O 
00 B0000O 0000 00 UU B J0U 000000000000 

huubbbbcbubbbbbb 00 00000000000000 

00 00 00 00 0000 00 B0 030000B0 00 B0 00 00 

actaa 0B0O0000 00B0 000 ■ 

&0 DA~A "253293e3d5c5*5dde5e9e 
lddel*lcldle3r_9cdda7all500B2lfeb0 
Icdb503cdei7ac t ?cdda7a0605c5110a0 

2 J 200 'it. dbbB 5 1 J 0*00 2 1 5002c db 503c 

1 IBeacdel 7j M -'?i-rirl^7j-' 

70 DATA " 24583221 eB0306Bac5e5: 
1050Bcdt}503*lc! 1 1 32D0ed5710ef cde 
1 'ic9r.dda7ifili, l 42 1 f 40 1 r5e5 1 1 B5B0r 
db503» 1c 1 1 1 290B 1 91 B* 0c dt? 1 7 at 9( d il 
a7a0t0S? t H403c5e5i I " 

HO DflTfi "1 545360300 tdb503ele 11 
1 7i200^d 52 1 ef t d e 1 7 a c 9 cd d a 7a060a 2 
\Ea03cSE6U0208cdb5O310*>.-e]<.110 
L*c d e 1 7 « c 9 00 00000000 900000900000 
0000000 0000 B00B00B0 " 

9B DATA "261 3 280000^000002 le3^ 
Li7iff cf f iGfvttBZaZal ID1B1 4ff2346E^T 
9+ d9643j004ed44 1 dl d4f 78* J9644300 
4ed441Sl547d?BSd9eScdhid24«>ld9Bld 
TlSC»234e2346Z3e5cd " 

100 DATA " l77220e5?2eUac2B0Bf9 
00* a0 1 4 aB 1 f 90BO2f a02^ E00f SOB03 4 a 



044 *B74 *074 40P00F4904 7B2f 700« ] i 4, 
024 6324 501 f 50B03F B0" 

110 DATA "09S 4823 4 3 0004 4 604*300 
BE* 7"B7 I 7B7 f 4sBCB6f 6B5f ^B54 SBt* 500 
0C f 530f 4B2f 4B0B5f 407 f 407* 500304 3 
02*3324 1 00BO4 2B0f 1 01 * J Bl * 2B0334 ] 
03+ 23 A * 201 * 1 BBBSf 1 Q " 

120 DATA "16£23<l5*307+3Be06f2B6 
4 10 71 ]C7*20' + tdto0d3G02c:d011facdfl 
2?bftbBe3i!412£lnej7_16B2L54b>:L34£>ZoL. 
dt6/dc:1 1 0*50^4 3065c 16B£>3ee0cdBD7 
d3a4B5cB61fe2U25Bl 1" 

1^4} 1>WTA " l4ABZll2eQDeDl'/7£3Qi,£. 
0f b 1 ? 1 Bf 61 * 1 4 1 + * M36d Sf ee60732d27 
ca*U dO7ct:30aec 109+ 40V* J 09* 203*6 

(«S* IHlHUll 'IflHHDl llflllBUVIhlfll't 

r49S64SS33aS3l6a?lt ■ 

140 DATA "7:63816534 34 fS2453a3fll 
6P9 1 4 4^444d4ZS3^a J^>1 t*3D . 44«4d4C3 
0203a3Ba000O0c5e5d5*5cdaaI2dl2l0 
45bdd7701Z2O65bfldlcda77dd3f5ed5 
U :6'j. f L-80^BO6d68atd " 

130 DATA "24S0865b7b5L6*26032°2 
929 1 9dd 360BOOdd 45,0122095be5dl 2a0 
6fb7a * e0028?b Ia0e4 i cb3+ cb 19 1 04 #a 
es 1 ae7723dd T eB12f c609470e#f lacbZ 
7eb21 IQfaaea) ae77f l" 

1^0 DATA "236609dlcda77dd5*5lB0 
21a/7 2a065bTcei07fe0720l77d+EB03 
FlPSl 1 20* * 1 8031 1 20*81 9244 1 c 1 Lda77 
dti5*52S2422B65b2a0B5b23ddVf;003dd 
d7 700fe0020B4lldle3" 

170 DflTO "271t,24c :c"Jo5f 57C04 + 
4 e603f i5B6772* 1 el c^c.Ef 5e5* 5cd0D7 
d79c6074**: 1 ^cd007rf r If ^7Bd6074?nf 
13c f 5cd0O7d?9ct074 4 f 13ccd007d* : :c 
11:90000000000000000" 

180 DATP "150660000000000000000 
090BO49ZS 1 c 1 c2«490G 000000 00 00000 
0B0000D0O 1 f 1 c 1 b 1 * 1 + 0B00004 B IBeBe 
3*131* I #14 lei f 0000009^78* 87Sf 8000 
ClBWPOB B ■' f ^0 ■ P n ti f r nci ' 

190 DATf, "1 778643030*6328705*- 
580B0b 7 b5B58585f * 050Sb5b5e505S b* 
cu000^^ 1 1 Wc 1 b l / l+0000cietio0dt(eH t 
SI 4 14 l-0tl7Z3O00BHF0f e*Qd0eBc40O0 
000002 'J 1 70b 1 * 1 * 1 *0B " 

200 DATA ■ | l532040ac4eUd0*H+H+tH 



f 1 7 1 bBt 1 7230000- BeBd 3 3BeBc 400000 | 

BDOZBI/Bl 1 Tjljf OBffBB^tfBbEhJB^LtL 
+3* I 70* 1 72O0000Bcerd3bOeB0400B00 | 
000?017Bdlb373700B0" 

.:1U lirtl4 " lifc(bi^»S4eiJ+UeB+r + c ' 
7 1 b 0d 1 7 200000* c * ceB* 0e8 040000600 
0331 70* If 1* l*00B0<?Sd0e0*0* 040 1 4 
f 1 /A Ali/KTrUUBliH Ue0rjU9^ctitJtiHUHUtJUB 
00 183)9030 7040000^0" 

22B IjATA "130996e0t:e8+0+eBf04 0! 
*07Bbl90S00f BfB4B*0e3cc0000H0O00 
B0dO3173f34000004ec*3f B*cf c3f 170 
I-Bd 08B0030O * t f Bf 0ec0400000000B00 | 
020370* 1*34 000000 10 " 

230 DATC* -174862b0e0eB*c3*3+1+0| 
+ 37200003* c* ceBcObB 1 00O0 0005a-" c 7 j 
e7e7e3c5a5a3c7e7eTe3c5a0000ba7c* 
e*e7rba030O5d3e7*7*-eS(l00B000"" 1 l 
7Bb I 8 1 b I BBO0098d0a0 " 

240 DATE! •137ill30b030ie0bi733Ol 
703B00030aBd09Bc0B0000000000 1031 
90b050c0B0Oc0B0cce8d0ie0c0d0cB50| 
b 1 9000018d8l 8d0e8te 0000000008Od0 
314 3e~eBB0004ec * 008 " 

250 T'AT=i "0693BlSc5z3i?14030da80 
030005c 03 4 E?c0 4 00 0000000000203 7 
4 10^aO0030010b0C0287=3A3al0B4 372 
000007c 7=2Gc0b01 00003000000 00B00 
00 0B0O 00 30000000000 " 

26B RESTORE : LET ==3! 125 

370 Fflft w^lfl Tn 7*fB <? _ FP 10- RE 
AD a* j 1- LEN a*<>136 "HEW PRINT 

"Length error in liie "tut BEEP 

. I , B: ^TOP 

2SB LET t=VAL a»i t3 b> : LET a* 
^a*(7 TO J 

27a ran? r -i to 65i _c- «*ctJDC <• 
*J LET b*C0DE a*t2J 

300 LET a-(a-4B-o9#<a^96> )+16+b 

40 (b>9&)«39i LET L-L-s»-tiYs POKE 

?,a! LET 3=?+l 

310 LET a*=a*<3 TO )j KEXT y 

320 IF t "H£H Fit INI "Sumche^ e 
nror in line ":st'' Ci *4eretice=" : 
tt BEEP ,1.25; STOP 

JJB KH1MT "Line ■;*;'" OK": NEXT 

x 

340 SAVE 'CODE 2' CODE 31125,162 
5: VEP.TFtf ""CODE 



rOUH OOMPU1 E R, MA RC H 1 9BS f 9 



iCOfttifiued ftvm previous page} 

be fan: typing in ai:d savin £ the completed 

version. 

T.ie control options will appear on the 
screen. The kcybo*rt! mjjuull u&-;s Kejs» 
QWER an J T — left, right, up and down and 
bon*b rsspectwelj' — which is perhaps a litre 
uwkwaid, but was etsie' to program and you 
may be in practice drcidy ("mm using othtr 
program*. II" y>u wi-h 10 ujc t'ne cursoi key*, 
press 2 and cei the Curse r joyslick option. 
When you are ready press tc sisrt. Tin: nb- 
jsct of :he game is to slay away fiom th,* red 
hup and to save as man; baby lerraphs is 
possible, You do this by cntctinR a question 

mar*. 

Go on to next level 

A baby terrapin will probatly .limb onD 
your back- You must lake it hone by passing 
1 1mm th tht hfuse which appears. Ho*ewr if 
you are unlucky, anoihei bug uill cnurgi' und 
you hav. 1 to gel away is cuickly as pottibte. Ii 
the rigli liuestinr ntirki. ir.ere arf two juj$ 
and iix nabies. When you have helper, all sis, 
you (0 on to the n;Xt level, *!)i«:h is i it- <aro# . 
bit a little more difllcult Mud i eifTirent 
colour. 

You get 00 points fo: cr.terLng a question 
mark containir.g a baby, ISC' pcitltl F<w tilting 



T/ie Baste program. 

POX E : 2 3S -" -:-- 

II" REM : : : : n'.er 

"" - E~ Lr?30i£0 _e~ fb=2t5 _ 
£T ■ 1 =C3-25S _ET ■:. =ii-£=5 

iO : X 1 " :S " -i." "TM ft 13) 

re Dlh fcs :• .= RESTORE R2R 
D ' b * ■ 1 h 1 1 £ . : s :- • . b 

" : ' . . - h'EHPSTDl "TICK 

a ;ls fob ^1 to :- psikt a 

4-cTifi 5 (>*■ NE3CT PPIK*" 

TERRAPIN 



:' -1 ■ - ■ -. -: - : . ArO b=2 

sdi . -- ssisee =qysE 

. :E?P . =■ »*■ "REEP .2.-33 
:£ - PPUSE 

£1C ST = ■■: SOSBO+aBBSPEEK 
£33? - EOR3ER d 

PIP i ft ,=; 

220 1= Stst U 7HEt- LET u*w-rl 

so -:• ~o--. - 9) 

238 •:_- : it ■ eONGfiSTULRTi 

3Mi ■ . n -,...- " " i-T-t 

'._ - flNC =£ "RD -H 

-- ~- RMD ■ ttlBrtEST zl? 

^E Ef-TEP IAHE 
FT ' « = 









- - 



~~ PRINT 

.-'.:: tie 

'f LET o=0 

SO PRINT FLASn ' - r h*a-6 = fc 
I i 

so pfljSE _-:v if :■■()• ^' *= the 
: : 

SS LET = =0 

130 LETT is-. : " a IF ■; * ^ i 

fiHD :S 3P ; la"3 THEN ^E^" S 

- Jfti. i| IF riO T a Tic-i ECt TO 200 

*is ir s thf". primt ct b.*a =- g 

■ : S -i" : -i GO TO SO - 

tao -t ■"- rrpRp=r 

3H : : :-^i rop r_ -- 

PRI:~ . « s • r ■ ~ 

:*5 LET = 1^ 

ilfl Pfiy?£ £53 l P IMKSV9 - -" - 
IE ir.t E, 5 ;-i' r<iEN a • _ ^~ 
:-^i 30 T" 5S 



sao pot e > ■ - : 



P-Jil - 



24.5 PBIW" PT = - " | 

- f 

£=e =fl- ! Sc BEEP .^- 5a _E T - 

ST=INKEY* !- ilsCMRS IS flrjD LEU 
rig ~hEN LET ns= : i TC LEN ng-i 

-c !i$ ■■■" ce . « ■■ fcce . 

S : - = . : THEW CO TO 2A5 
260 - = iB £HRS -- R!C- L£*l 

O THEN -ET r-=-.SH, :S .;-;• -.: ^^=- 
= fr= IF = c >:» 13 THE?. :■> 

aE 
B7'0 F05 =7 TO U .rTEF -1 l= _ h 
> -i =5 i i J" :! +'.) -a*<> 

- WE<T _=t g|,]i: LIT «;i 
., =r, - 

.-. ,• J . . 

loso bolder pppe^i q :r;- - z 

^eAS S94.Q0 LO*1C . ;c^ 

SOOO PEM RUM 900C T3 if! 
B0tS SAVE -TERR^PI! LINE '0^0 

ii C: : C-E CODE £*5O0 3£< 
IF^ IJEPIF " ""E •__:- - : 

ir." e- . ied Oi- " ' JP 



tht baby back h^ruc, 50 poiirs li»r stunniny a 
Hut and SO points for tnLurin* a qtetttOfl 

mark contain! tig a hig. If you gc: a high score 
you ait asked tc enter your name. 



Ihe levclK JilTcr in the ncthndof controll- 
ing I he tmgs. The/ start off raii^m and 
become more uttracied Lo you va, you finish 
each level, 



Ptagtutn 2 

ia BATSl "179l3i>t«2:B45fci2ifiBa92 
2 405b d d 3SBc 0Bd d 3h Jf 0Dbd3 63«E3cSd 3 
t ^ Bi 3 J ii s&4 j a i z t # c at> ^^4a^D s, bKUdd J 
t24 f f ddlt34f f dd5& 14* +2 1 1 9Sb06Oea 
E0B3eEI3cJ 167af pBB20" 

Zfl DATA " 1 BliH iBa / •* t (Jld^lf tfHi 3 &D 
20t. 183231.0 1 231 3i'0 79 f t>0228 1 £,,3601 3 
c08-.dJ6/35+lc,3071 !9Sbl?7l?f«?Bt22{|id 
tZ3lB+ea3/eHt37B7973J'»tElCdOi60*V 
a2ia0af 221 IbbddjfcJfc ,N 

38 DATA • 2232 t *a(»rdfc&7 ( zcd2t.7A2 
1 70ra J 1 Z£5bfleiflbcti4eecl Ar»^4cit?d aBO 
3 1 af ef f 280 c 3t- fl0 i 2 tli. 1 6 4 23 eBat d h i, 7 
dd 1 L 3«d«0ecla0r 1 1 QdeG 1 0BBf ed430cS 
oca*378cld3t, i ^o i«6i^" 

40 DATA ' lSa3-a-fti7si.B#ddd3bl22 
03c dd 36 1 2052 1 4 e 5b 7e f e00280d 4e 234 
&z s i iikss ii^ica bb > a i St?edd7e : 4 f e+ + 2 
00^0 1 435c 1 6063t? B0c d 00 7 ddd 7e0c f e0 
0230bed4b USb 1 607 Se " 

30 DATA ' iii:vj/t«titilb67dcd^78c 
de6 7 Q3ai3dc3Sl L 4t3d7e4flcc 1 03dE?00<Jd7 
740c d;c 7 jc 3 1 4 75dd 7b 1 *f »f F 2803d d3 
3i4ca4/,nr\Mtii.eza40b3l J0f 001922485 
bdd S43* Cd# *?7acd 2b 7 a " 

60 LATA M 20S544dd7e3*fe06c.a6,t7 
Ac J 1 4 /5dd /eHef e«0c2 1 47521 c07e 1 1 1 
9Sb?»* BB02E75 1 a+e02>2S L 27b9 lc60?f 
e0e 300<a 237e90c 607 f B0e3Q062b2323 1 
3lSdf lateaijibiVeDr)-" 

70 EATrt "l9l7232ft40Sbliae0atQ2 
2403b 3e0Od 1 12tdd*f 7aec2b7add7e2f « 
(?t + /idKie'dd^tiJf Bae 1 4 t2t 4BBd£331 5b I 
B29dd36340ae 1 462b4^ee43365b I H 1 b3 
e00 : 2cdad7ci2a40f b 1 1 " 

OU DATA "1914720a0B19Z2£05bcd2 
b7add360c< f dd360f ikc f c763B24dd 7 
e4« • piaa2B l ddd35402a4df>bedSbec5b 1 
5l5:tic7323722326©a2i4aSbcde97«C 
d 2b 7 a 06052 1 225b c 54 & " 

90 DATA "324347234fc237»cb4e23S 
e^J^623+ e002BZ5-f e# f 2S653d 2b 2a 2b 7 
7232323d 5e602c5d 1 c 1 f Scd5279 C 6B#4 
4f 14779e5d5cidledb&7dl844E5c5d5c 
l e lCd797«»cd76?6B5c5 " 

109 DATn "233297elclc:dd97B33S4c 
deb7Bf5o5t:5elclcd3275cSe5clel 164 
2r60acdb*7deb-f 1 el 2b722b732b 300SI 
6?f cd 1 37bcbbe2b702t-7 12323232322c 



ilBB3dd7el2fe012022 , 

110 DATA "2l6545Z]c07siti9Sb7ef 
kSB2E 1 7 1 a ■* eeazEfftci ts2 i^^^n obi & 4 2 J. 
eB2c db67dd I 2323 131 Bb4c 30 3 7 4e d 357 
be ^dd35SBCd2ti7a3eb& 1 607ed4bl 1 5bt 
dUfi7d21S^5b0t»0t:ca4€f 

120 DATA ' i 253E3423*6237efeff 2B0 
b3ebBedb67d232323c 1 1 0M040ac57Be 
60 : S7d^fl2S7«ti4b0k.3b^H9ri.E:dtie>7aDe0 
dia+e«d: j Hf br i I0e5ed^b0=5bl6a73eb 
ec db67ddd7e0c f l4 f 20 

130 DATA "2Z85758Lil i?5t7efeB02 
32Bf a2b J601 dd7 e 3e- e00dd360f 7acd3 
60e 00c 2c 273« d 7b3d 5c c 37*. 1 fc d d T4 4 1 d 
d363f00c35a73e5c:5d5eb2l2S5bO6052 
*237e2bt «B0 38 1 27e9 2 " 

l £ DA' A '■2t,B792c6e7fe0e30aa2b/ 
B2393c607f B0B380a23232323 1 0e0e lc 
lBlc9ctlele]a+9047af9l4*c<;i:d517b5 
*.2h5eBd4D0eblsflf9047af<?l4ffe i f200 
105cd3279cb3+cb3f c6 M 

150 DATA "251966a#c5d5cif5Sehel 
^07cda67d 1 *i047Sd604 4779c 6044* f 1 d 
4361006 1 d 7M d 1 520^ a I606cd007de 1 e 
509e5; 1 dd 33 1 020eb e 1 c9c 3f f 760 1 ^ e f 
bec7BU000Bch47?00] " 

160 DATA "243585^^4*2001 LccbS 
72C01 1 4cb5f 2001 1 5eb67372001 3f c90 
Ifef 7ed7a2a00cbih72802cbc501fee+e 
d 7G 1 i 3ee2cbe5ad?6flead 1 3c5db : f 24 
74f Of 0f 4 70 7 a , ?e6f 5a9 " 

170 DATA '2lS3?Baa«6faaBlBlj27ab 
3c Bcde 57 728 1 6 7aS220067*033002d5c 
t c 5f 5793c 200 1 05090 fi I C J £ 9XF 57a f e0 
02Q 1 07b f 1700290 b 7 Bt B 00 2 804 J fofiei 1 RPI 
21e0Of 1 cd9377d5c L3B" 

1B0 DATA , 3!35Blc60i000BlBdlf57 
b+e01 200a* icc4f 2003* 5 1 Battfr q+*»* 
#2006-lcrj5f2Bf5rS7a-fa0l2006f lcb4 
720&fl^5*»f f 2B06f lcb5720e©*5f lta7c 
Oc Sd SeS7c 6o07f BB720 " 

190 DATA M , i46c>41d7dB607201Seb2 
:f0777efefe3e0fhba320047eja28012 
3231 BBf 237eb f v I d 1 c I q f 00a f 3£>: «,i f pi 
e30af Oe40a~ 0e40?f e 1 50a<f0eb0af 0b3 
Oaf 0c :09f 04709f 8400" 

203 DATA * I 34l44£f 07tPflf Sh^PlOtPl 
9303* 07408f CeSeSf 0d60B*0370Ef 0hB 
0B f fld 007* 07 307+ 04507 - 7807 f 0d3B6 



1 0dSa6*87005* 07 1 05* 8+ ;B5 J BE 1 06+0 
6706401:605* 02 705f f ■ 

ZIU DATA "08421 4805f0d 104*03304 
f0d3O4+07704+0*003f07303*0d303f0 
7BB3 i 0d00M07 1 02*0e202f 0C3C2*«74 
02f Ot 502f 0d602* 06702+ 0eO01' + 0d 1 1 
+ 0140 I 104 70 If a- 000+* 

220 DATA "222?6J0320B+0b320fBb4 
VHdt0tb00fDb600«0bB00f09+tcd*e:762 
A0^ bt Bd4b0i»33 c d T> 2 7 7ed 430e5b22 Be 5 
b b5 1 604-d 32 79dd86B* c 1 c 3b t> 7ddd 7» 1 
4+ ?* f 3+ =079 f e4B373* ■ 

230 DATA "235"40e07Bd65c*B06c9d 
d7eCrE9l :607tff0ed0Jd7B099Or *R7-f« 
Be9e52i4cSb7*a72B3c2391feB87e233 
0* 492e60 ?i f?0ii30ed;5d5eb2a4aSbh7E 
d32efcld5ellalb7Bzl' 

240 DATA "257}352aB2BdbOeb36002 
24*5t)2a4Q3b0ie500a922405bcd2b?a3 
7dlt le lc9e 1 b7c978E» 1 20033e04c9?B+ 
B002e033c87e?7 l ?3e37i;60Bt: < 'dd7e0c* 
p0(l r Fd cl 7 L *e d 9 W B02 d0 ' 

250 DATA "223£6Bdd7e0B90*eB2dBd 
d3«0*9add36Oc0(f3ebfcd960Bdd770£>* 
ea*37c03ee0dd9£0ddd 770:1 37e9=dii57 
7c 2647 7 ild7e 4 I c * 02cd 1 67 a f e02 JH ^ Blrl 
d 7«08 1 1 1 1 95260310 " 

260 r 

270 CLEAR 29499 t RESTORE J LET 
z =29500 

230 FOR x-\Q TO 250 STEF 10 

290 ^e«D at: IR LEN af<>13& THF 
V PRINT "Lengtb errcr in line "; 
<: BE£P . 1,30j STOP 

3B0 _ET t*-VAL a* : Tft A 1 1 I ET -* 
=a» (7 TO ) 

310 -DR y=l TO 65s LET 3=C0DE a 
$1 LET b^CODE a*f7l! I FT >=(a-4B 
-Sf* ( a>"?6) ) * 1 6+b-4B~39* (b>96) 

320 LET t-t-a«yt POKE i,at LET 
I«j + l 

330 LET a*=a*<3 TO ); («)tT y 

340 IF t THEN PRINT "Stjmchtefc e 
rror in Iin» "at'" fti *-l»p(»rlC■= ,l - 
:i BEEP .1,25: STOP 

350 PRINT "Lin* "IK j" BK 4J : NEST 

3*0 5AYE "CODE 1 ' CODE 29500,162 
5: VERIFY """CODE 



CXI YLfcJH COVtPUTEfl, MARCH 1985 



*¥H fl I^HIBAHXIQ. 

rm got mi the 

l BITS FROM cXERY 
OTHER HQJC COMPUTER. 
AND MORE . I HRUE A 
64K ML'MOI -:'/. LIKE: THE 
COMMODORE 64. fl 
CR5SEHI INTERFACE, 
LIKE ">€ BBC f'WC 
"YSTICk PORTS, LIKE 
..E COMMODORE 64. 
BUILT IN PCWER 
iPPLY, LIKE THE 
C 16 U5RBLE 
COLOURS LIKE THE 
RCORN ELECTRON . OUER 
"ILL STROKE KEYS, : 
E T\\[ 
RIOSE SLOT, LILC 
r COMMODORE 64 . 
ft PRINTER INTERFACE, 
LIKE THE ORIC RThV 

WD OUTPUT THROUGH 
THE T.W, LIKE THf 

commodore 64. gn 

did/video output 
connection, : 
the commodore 64 , 

RE" BUILT IN LIKE 

BC. fiND: fi 
SEPARATE 1€K UIBEO 
MEMORY, UN MOST 
NQN-M5X COMPUTER 
SPRITES, PORE 
" m MO-3T Nor- 
MPUTESS. ni\D I USE 



[iettt&afl^iiiiiiM] 



_IKE LVLKi 
JTHER M3X COMPUTI 






HJliHiFll 



SPEC If 'CATION LIS 
LIKE THAT, 

■JNDER YOU'VE 
COT ft 64K MEMORY. 






m Sj- 










mm* 

- j 1 — ■ ■ 



■"- -'Tji Til • 







■ ^™ »»-f^«fc^™ ■ i . i .m ^^^"^^ 



■$m 



»»*s 




You'd expect one of the best-selling 
home computers in Japan to have a 
specification list as big as its memory. 

But the Toshiba HX10 doesn't just 
limitHself to that 

Jt was developed along with other 
Japanese home computers to operate 

FOR MCRE INFORMATIOr, ONtHl TOSHIBA 



o n one la nguage : M S X . You can swap prog- 
rams f games f cassettes, even peripherals 
like disk drives, printers, and joysticks: 
they're aD compatible with every other 
MSX computer. 

All of which makes MSX the system 
of the future. 

HUO CONTACT TOSHIBA (UK) LUX TOSHIBA HOUSE. fRIMLEY RQ*>, 



So if you wanta computerthat won't 
be obsolete in a few years, buy an MSX. 
If you want one of the best-selling MSX 
computers in Japan, buy aToshiba HXIO. 



TOSHIBA 



MSX 



FftlMlE Y. SURREY 3U13 51) TE.: [0276; 681691 



i ^m^m 



CM 

v.75 





UILL 




o 



The New Force 
in Software 




THE GAME OP DEADLY DRIVING 

BATTLECARS 

48K SPECTRUM 



£7.95 



(£= 




mmm 



£755 



"You know you've 
got a winner the 
iftsiantyriu open the 
package go ogiani 
buy i t today! ' -PCA 
The only Reel Time 
simultaneous action 




he™ 





Magic and death, on 

t % W & tha plant of limbo 

flr U i for 1-8 sorcirers. 

MX H*****®* * Over 50 inimated 

"A >* 1t*i spells to summon 

l"*^?"tt "** fnim the depth* of 

* ..jgT ^¥l hell and beyond! 









:-^X- 



aSES 



BSE 



■ 




KKfia 






WW \ ■■ J 






Gsmes Wortshap games available From alt good shop; or direct Irom 

GAMES WORKSHOP MAIL ORDER, 27'29 SUNBEAM ROAD, LONDON NW10 

with Tills coupon. Ftease flush Me iilcic boxes}:- 

■ Battle cars (48 Spectrum} „„.„» £7.95 

| Chaos I43K Spectrum} _„»„„ ...£7.96 

Talisman (4SK Specwjrrj .,„.„.._. £7.95 

D-Day i48K Spectrum* ,_. ... £7.95 

D-D«v \C-84) ..„..„..„.... £8,95 

D-Day itttJ ... £24.95 

Tower of Despair (48K Sped rum* £7*95 

Tower of Despair fC64) .......„.„..„..«;.« £8.95 

K a y of Hope (48K Spectrum} £7 . 95 

Cltequess'POs made p«yebl« to G^rnes Workshop Lid, 
PostSt Packing free in UK. Oveiseas add IE"? to total cost. 



' 




GRIC/ATMOS 

OTHER TITLES TOR CUT 64^780 SPECTFUM 2X51 AVATLABL3 










l .'ATI 



fcL££J CA7EG-0EIC factitsa 
fame), Tate (ommazd of ■ 
crane r engagad in battte 
agalMt flatter plant* And 
submarines. Use the radar 
and sonar lystenu to detect 
ind. A n ttray th p. nn*my before 
you are sunk. & 7.9 5 



' | 



■ 




■jKHjl TYRAHN (adventu- 
re). Can you find jc-^r v*y 
Luuj^i Llm labyrinth ind li- 
berate Qua w Tyrann from Jwr 
tirroent? ADist-ckss advsn- 
tire {uie with tail aid pa - 
phics.ifl.98 




Cttfil STTX (arcadB). Oes- 

troy the castles of tie Dirk 
Out which gjari" tie river 

fityy. Stru*£tf agiirut v"iltu. 
res, the eyes »f tfae devil and 
his miaions to vanquish eviL 
AS.SO 




E3UTHI DIABOLICAL TO- 
WER (adventure) The Diatoo 
Ileal Tower ba£ 60 Uoors, 
each ore fraught with danger 

You irissioD is to seek oul 
Lhetrewmt. 4B.B0 






y • ■ ■ - ■ - 




■■M:!J TJ1UO (utility) . A m»- 

nitor/ie bugger to debugyotr 
pr 3 grtmrr.fi & in machjie eo da : 
posititnrf in:orr,jJ mgl tiers, 

sa; breakpoints, stat/ through 
programmes. A 1L9E 



W3S5t^ 




IMULTI FILER 

40K Oftic lyyrrHoa 



HEfTO WULTHTLER (busi- 
ness). A powerful program- 
me fOi creating files. 01)0036 

yo'or own criteria adapted to 

yoir requirements Rapid 
sort and search features in 
mEchbe code and pcssibility 
of memarisirg tvei 30000 
character!. Extremely staple 
to ase. A 14.93 



'ATMQS TITLES 



ElTAILMfl CONTACT! 



oPTinun 



f 






0»C.1J«"MO! 



I'»-H OPTIMUM (home). 
Manage up to 4 different ic- 
stunts, keep track of cxpeii- 
dilura ant conpire trtti your 
monthly or yearly bidjtt 
Jul emit yon aeei to kesp 
tie household at counts to or* 
dir. A 9.55 



PANIC 




<J«C-17A|rVL^ 



EMI PANIC Action). 
Gttch th* miraidijtf apple a 
by setting traps. 6 levels. 
£6.93 








IBWa FIRE fLASH (arc** 
dc). Prevent the aliens from 
sabotaging the fuel depot uid 

■void eiemy fW lijr jasauyj 

into hyper space. An attraati- 
w and chalteaguig node ga- 
ai: .ii JQO 5 * nacMne code. 
AAJM 




'■■i' r,F |f I,/, 



BETEl THE HARE AND THE 
TORTOISE (education]. A gu- 
ile ftr 3-8 je&i Olds; to teach 
the aoUms of right, Left, ap, 
dowi and counting Ths hire 
and the tortaiw decide to ra- 
ce. Who trill wis? Tlw level of 
dHAmlty it adJtiftabU ta th* 
child's ability. A 8.30 



7 ADDRESS BOOK 


avsun 


i bank account 


J. 12.54 


9 basic plus 


.E.9.9S 


& COMPUTER ASSISTED 




DSSI&N 


18,90 


i CHARACTER 




G&NLBAIOR 


& 3.50 


3 CQNCOURS RTPPIQUE 


£5.95 


4 CW MORSE 


£14.9$ 


* FINANCIAL 




CALCULATOR 


A9.9S 


7 INVOICING 


A 14.91 


3 LEARNING FORTH 


£ lfi.91 


9 LIBRARY CATALOG 


£J,95 


; 5CRE3N KIT 


A 4.91 


3 5CFE&CCPY 


A 9.91 



CentreSoft 



MAIL ORDER' 
POST COUPON TO HTSH TECS UHTTS ISfZ CONLON PEVELOPMENTS WATERY 

LADE DARWEN LANCASSiIHE 
PRICES INCLIUE POSTAGE APQ PACKING FC R UK CNLY 07Er.SE AS ADD U. 



EEF 


71TLE 


0.TT 


TOTAL PR13E 




































■ - ■ 



Eal I 



OH ASK YOUE DI3TBIBUT0R TO CON- 
TACT ITS 

DISTRIBUTORS ASP 0IEB3EAS EN 
QUTJUB8 COSTACT: 



JANET PILTON, INKELBC-NQ MA.Y5 
LAND 110 BIS RUE CD GAL LECLStO 
93506 FANTO1 CEDEX FHANCF. 
TEU: 53 1-B40.E4.31. 



rWGlffiqDE ill CLOSED OR DEBIT ACCm"Vl£A 
IP CARD tiXFlHY DATE: 

IMPORTANT: Ail thaqujs or eaits payable Lo MO BAIT'S 1 ,ArID and Esnitc High Tech. 

NAME - _. 

ADfiBSS — . 



KBTOQDE 





Available on 
TelesofL 
See page 97 
for details. 




Brian Lewis 

shows you the ropes 

in a humdinger o* a game. 

You l'L,\Y ihe part of th: famous Qiksi motto 
whust: on I j uue love Esmeralda his been 
imprisoned by evil French soldiers. Ynu must 
rjsh Tfi invc her by first clearine 14 screens to 
reach her. To char a screen yon just first 
reach | hi: far right-hand edge of the screen 
then you must jump up to reach the bell rope. 

Lose one of seven lives 

If ynu arc hit by an arrow, a spear or you fall 
down a hole or pit you will lose one of your 
s;vcn lives and sari one*? mere al the lefl- 
hanc side cf the screen. There is ilso a super 
lunui wlitric if you gain ibuu lulls by :1c line. 

Four screens without losing a l.fe you will be 
given a LOO point* bonus and ifvOu iilanaic 10 
reach Esmeralda then yju will be given 403 
joints and arc sent back to the Mar: of the 
unuiic but tliii Liuic lilt gsmic wil. be fanci 

My main prnhlcm wa* th; small amoinl tf 
nemory I had ic work wirh which made t 
hard to cram in the 15 screens and forced me 




Frogran 1, 

10DATR16,48, L 12, 112,96,32, 16,46, 192, 240,160,96,16,3 

2,192,172 

20DAT A9tV t 96, 96,1 12, 40, 16,16,16,224,224,224,76,172,1 
20,128,192 

30DATA16,4Q, 112,112,76, 32, 16, 48, 192,240, 160, 96, 16, 3 
2,192,192 

40DATA112,112,240,240,48 1 1 12,96, 112,224,224, 112, 176 
,192,96,224,112 

50DATA48, 240, 80,96, 128, 64, 49, 48, 128, 192, 224, 224, 96, 
&4 ■', t ?ft, 1 99 

60DATA 11 2, 112,112,96,4b, 16,16, 48, 96, 96, 96,224, 192,1 
20, 128.128 

70D ATA48 , 240 , 60 , 76 , I 2B , 64 , 43 , 48, 1 2U , 192 , 224 ,2*4 , 96 , 
64,128, 192 

B0DATA 112,1 12,221 , 208, 49 , 96, 1 12„ 224 , 224 , 224 , 24E , 240 
, 192,224,76,22+ 

70VDU23 , 1 2S , 254 , 254, 254, 0, 239, 239, 239, 
100VDU23 t 129,0 1 24,24,24,24 t 24,24,24 

(program J continued on pays 67, 




to find a way to condtim the screens. Sc I 
bas^d all the screens on a brick wall and ih-n 
devised a system where each time a screen was 
displaced a brict wall was drawn. Then any 

SKtras — filtlr liirr**!!, anil pilS — wiTf Cut Out 

of ihe wall. 

These extra arc dso stored in a condensed 
iastuor. which usej a form ol bleary, but 
instead of represent ing numbers, ihcOs iiid Is 
ttft t u ni flrr.^wf,, K-tlnVrc, mrr«Jt, fir., and 
these binary numbers arc stored in line 40 of 
listing 2. The number 0000 represents a bell 
screen as this screen wis a very ,ate addition 
to the program and so (he binary number was 
too small to cover ail the variables 



^^^^m ._- . EhPH^hI Written in Mode 5 

~n*ZJTZ^' I ^jJTSiir*^..jg^j2r^M The program is written i: 

^..r^-ITZ^l ■^-.^"SJTSiJtUw^M prwid:s t reascnable aniai 

|?ti^-^^iH I . / ' JP^ JT^— ^*^^5Jg good resolution in four ci»l 

•^■^STiiTS-H ^..r '."{' Billi'^^r ^J'lS. -^ J thai is needed to write an 

^^ T* —' ?J ' ». .'f ' .- ^ .^^»^w*_^J?^M game. The gum? is written 

^J«j«^*J^Sj I ~ - ; l , Lfci — .T * " 1 ^— -^^**^^B hut other functions which 

^^^rUT*3 B^^^^^P^^^JSti ^r ^Jl speed are written in Basic / 



The program is written in Mode 5 as this 
provides i reasonable annum of memory a 
gocd resolution in four octUmrc which it: iill 
thai is needed to write an addictive ircade 
gane. The game is written in machine code 
hut other fund inns which Jo no. require 
speed are written in Basic. All th: screens are 
cor.dcnjcd thus making ihe lift m|; quite short 
and th.s should aid »ou when you are typing it 
in, Hrwcvcr this type or screen stirage a.SG 

hat its disadvantages, a scrohnf? routine 
(continued on page 67) 



YOJR 20MPLTEH, MARCH I9B5 6$ 



One you bnaae enough 

to enteu tine savage would 

of mighty Conani 



You've experienced his 
barbaric world in mcnripv 
novels and comics. Now Co nan 
is ready to spring to life in 
your borne. 

So flex your m usclc s and 
prepare to do battle. 

Tout mission is to slay Conan's 
wicked rival and bring home a 
bounty cf gems. Blocking your 
way are fire- breathing dragons, 
poisonous seorpicns, vicious 
bats and Other deadly 
adversaries 

If that wasn't enough, you also 
have to fight your way through 
dark cave* and dangerous 
dungeons, white looking oat fur 
mysterious creatures waiting 
their moment lo attack! 



A 

ATARI 



Commodore 64/ 
Atari Disk 
Commodore 64/ 
Atari Cassette 



£14.99 
£9.9$ 




FAMOUS FACES'* from Datqjoft 



THE LEGENDARY 



BRuce Lee 

TWenty Secret Chambers • Dazzling Graphics 
• Unique Multiple Player Options 

Spectrum 4SK £7.9$ 

Commodore 64 Cassette £9,95 

Commodore 64 Disk £14. 95 

Atari DiskJCassette £14,95 






'□' 



kuljh 



& 



U.S. Gold Limited, L nit 10 

Parkway Indus :nal Centre. Keneage Strep:, 

Birmingham B74LT.T*!: 02H59 )02C). 

rwu™4 + * i iraft-ei^ ■ilfirt if Pi Mil* h/ 



. 1*14 liku Ih^xrin Ik. Cm* i 







^ 



ht 



wal 



in 



(mntiniKXi rVrsm pagn 65) 
would be impossible is there would 
n>ifhrn<! to irroll unto bul B pktn brie! 
whareve- i he (bee: w»s. 

Controlling Quasimodo 

If Vim arc liHikiiig for somvlhirig lo a.tn ai H 
i be way of scores [hen my personal best is 
4.500, Jl'y™ led ihe ieci tc design ycur awn 
screens iben you ;ould change the 'binary'* 
n i rubers in ih; data ytaivimai at Una 49 of 
litiing 2 bit rcnemb*" ihai wme of the 
combs n aim ns avid able offer no sorr of 
challenge u,hitiKiH_vcr — i.e. a ;lat brick wall 
with an arrow flying cverhead — ard there are 
few ton-.hi nations ] have not included in th* 
!S &cre:ns within .he game. To control 
Quasimodo ust ih; kty 2 T.-'t. X R%ht 3 
Shift — Jump, io ipke a run and ump press 
bidt a dirsct jo nil key and the jump key 
together. 

As the game was wrirjen for the Electron 
HBC owners will find it too fasi. To stow it 
djua change Me values ;dM*(l)and S1 J (2) in 
line 20, SP(i;-lfii> should skiw the garni 
dsvo tiffkiemlY- 




iprtgnm I conttrwsd iron p3Q£ e# 

! 30VDU23 , 132 , 24 ,60 , 1 26 , 23 I^ 3 i;i 2 ^ 2 ^^i 2 
140^DU23, 133,231 .231 ,231 ,255,255,255,36, LB2 
1-0VDU23, ] 34, 32 ,32, 32, 32, 32,32,32,^ 

1 60VDU23 , 1 35 , 32 , 1 1 2 f 32 , 32 , 32 , 32 , 32 , 32 
17{3VDU23 T l38,:,3,/,L3,3l,63,l-7 l ^b^, 

1B0VDU23, 139, 0,12,30, 31, 15,7,3,1 
1^0VDU23, 1 40, O f *B,i2B,24R,240, 224 ,192,120 
OTENVELOPEl, 1,-90,-3,126,3,10,4,126,0,0,-126, 126, !2 

ZlflENVEL0PE2,2,-9a 1 -3,i26 f J,lB,4,i26,B,«,-»2A.12A,l2 

220ENV t LUPE3,l,-90,3, ^90, ie T 20,1»,12i,0,0, -126*126,1 

26 „ ^ ™ 

230DATm ,0,3,0,1,0,2,0 

240DrYTA0,0, 0,4, 15, 4, 0,0, 0,1, 2,2,15,^,2,1 

25000^1,0,2,0,255,0,25,0 14,15, 

lAO-nfiTAH 0.0,0,0,0-0- 1 ,18,32, 112,413, 9, 7II,10,lH,iJ, 

!i;;^i;!Ie;n2;!7:34 ? ^;72, 192, i92,224,24 8 ,60,68, i92, 

1^R^905?rQRT=0TO223:REA0 Dj T ? G-/.=D S NEXT 
2Q0MODE4: VDU 19 ,0, 4; 0; 



6 



290PRlNTTftS(13,3>; H H U N C H Y" 



3OTPRIN1--In thi- 9«« q»» V- pl*V «£**£ H BA 

CK of NOTRE DAME, Your only true love EZHERALDA has a 
en iflprison^rl by the evil soldiers- 

3iaP*INT»Your task is tc -*ve her from their *lu 

thenefbut *t< is not a. *«y « it sound* - you «us 
r first clear FOURTEEN screen* to reach rtor 

32BPRWT-'M+ you clear a screen then you gain a |C 
ujJSri you hL« four -nHR*i30:"s then you «i 1 lb 

fgWen a SUPER BONUS. But if V™ 1°« **■* one llf 

m ynn lose all the bells ! • " _ _ fRH 

330PRTNT' "The controls are:- £ "-^i 

T shift - JUMP' 

340VDU2B , U , 3 1 , 39 , 26 
350CHAlN"HUrJCHY2" 






pfCdnm ? 



1_ 



Lnu«Ft*»F*ia,l *«*«, t ufi - TU SFOTT lt« R 

soKtbiune^ 

TWHOOTftBT 

JSnWSi?«*SRST««.-r.™ i^W» '*« ■ 

,, 3^3KS«'«.«««"'»-<^«-»»w' ,FI, * 1,>M 

Then pnOTBUNlJ^i 

PSINet t i trjLW** 



JB t l.4■^™f : ^*■J ?!: ' rtB,16 ' 14,fChMl:5^, 

52««MlCSH^t>OJi 

p* i tih>:4> iNFm - : ran ue« 
JOWUlOBt 

4«|F0fiT-ft P UzSTtP Z 
•TBttPtT 

4Mll.r«*<IBI.CMW1:BWNST 
^r^l^^^^-^^^llLP^^^^ 



1 



YOUR COMPUTER, MAflOH 198a 87 



(Ganttnusd tram p'evtaus page) 



MM JSKSE EI i LDflSi 75 1 C1P43 : BVEi : J3RS*tE t , " 

ilBf Dfl-UHIH jCM^»Wr :*MG;i JUPtlBAilp ,1c 

ft*«l4Jflfc74;UW>|tB; BEQe 

HiVA Oliit,Rl;l [;f*r.TF. : l DYHEFf : JSHLFrpt • CPYaSFF :BMte 

64BL.0AS1 iSrfliifB: JSfSrubr DECJ-7*: aiC:L0A^7^?^6cii&tS"*T 
1 1 L0A473 I >RT*» i STrtt ?3 

6»L:>A*n2 HOC ^*:Glftr.7B!l.DA»r|2 DlV 2 !=6 i ? I Ar.,7 J I J BR »n 
1 

&»B. t L0M T 4:CF1FF3BtbFr.<*;lDABfcttJ*LCxiilCD:LDYBM-'i,TSR 
fcFhFiiCP¥#«,fT:DhiEtl 

bTBL&AUHl l*Ob i3*:STftf,7B!,.)iA»ni OlV rfJIjiSlrtA,?! 

69BLl'fitP:STfi6*a:JSfirub;JBfiann IN-i7t:clds LDAk7?;ADCi 
H:ilfif.?2ilDflt77iftnrJiB t LiTAt. , ; 

&*r>, a i. UA47L i CHP»B I B^Eei LD^#68 1 : LDXt«F F 5 LtV S&FF i JSFfc 

Ffr^:rr*V»IfFlB1*i»>L0ftll]!'jrft(.?5:Ll>n<Bti,TflLr)|M:LDiCiP-!LC)( 
*H,a5: LUV#*J: JbRfcF-F I 

f"tHJ!WjU*p 

723. g .THP*t*T-t 

73fl. rub CLC:LIiAfc7=:: A&f!BMB>i5Tf*4t::Lfin*73f rtuc»i . 4rnfi4 
I'-lDCM- a i.i:**tf-&t,-i<!.,.-> ,Vz r -laiK4V-> ,Y: 1WV : rfYHU.rDNfcA 
iRTS 

74B.tlBl*¥ LMttl3Bl.E3 LDVioa^C OfeY t P*Cl BE* : bUEF;JiTS 

75*. JH-mp iHCAI^HiLLflWOOMPT'* ' = t-" -O 

T+W..L>' 1 *e:s p Ft?ii .1FFSEF 

798 j-bftr ub: SEE: Lnfl*72i 5BCt&4a* 5TA*?2t LDAV72:S&E« I *kT* 
473«JSR3EE?[RT'g 

TVt*. dun JSR-utu CLCi LW^l AUC1MD; SIAt-72: LI3AS.715 trtOC 

#li STA17 is JHRSiFS 

^aa.nh] t_JYp.fli.F LPrt(*f.C),¥:EO(»%'mD,V:BTrt<lj«J-J,V ( ihrv 

IttBLDVwE):., het'l: L Vt.ii.tCi ,YiOlT«fl; PNEhi t : INYsLPYB lir B 

'.'.'a ►■■* Anea.ij c«r rUjINfcr iitil I :Lnf'*"-M I '.POM VII p.nplil 
: J If e d(j t* ) 

84B.G .rP.dc,e:: .wu ldy**»i-h iDnnai.^i xoi-iiu.Yidm 

l*6C» ,Vl IN Y; Cr-1» 14: DhFH 

Hnra 

FfcH. ndyp 1 L0"*6Di ChP *'■•. A i "I (.'" ] JHF G 
F7B.F-" UW*JhCTCMF»Lr»: FML.il J 

buonw^wiire: RrAt,*, >i ijnw.f.ri, ni>i*^T>: ,u»w jut- n 
Lpva-mgi-? t DA5nf>DiCfiP»fct,7iflf,aftt jnFWH 

■9BB.K LDAifcC::MP4BrB«Eri< 

9Zfl>.<4«4 L0ft»«;a-«<T6iaHH|»t;:SlfHiL(r.s:iTWilW^lfTfl'*lH 

STFidMM 

VIB. : JBktfiisl FjA«7il Orfl'^it OYnJ.nt 1k»~* n •■ i ilBIMI . rt'-i- 

»ti4fl « STA&7 2 : L UA». 73 ( ADl^i 1 £ B Tflfc 7 ' i TS'h (1 1 ft > J^ROv I .i f ? 
VtB JHCi7i:l .tinH/ArCHf 1 * I "•: PM. 1 

■74B.<»« U.CH.DFV&?f:A0C*l<3U^1^40:LCA&r^:tl7L-t|:5Tn»4 
£tLOy»0;. J I Dflf*7?J,Y; :OH<*.76i ,Vl S'A<t72} , ¥t lNt jCPY#[* 
i^MEJi-K (_W«1<4DI ,Ti£U«(6!'a> , Yi STfl *(«> , Vt IHYi TPVItlSitl 
ICK14T8 

<77J,d>l«^2 tO USB: .fll LSY»5(*:.1J1 UT^ : PKrHr HOC: RJFm 

VB&.-fin I.DAdDaiOiCllF't^i BEDrrs: JhIPh«a:, rr« UMWtUHUHi 
*a;LtV**' 'SitrrrtiLtYa^: .Hfi TYftrHAc .ISRthO ar: Pl.fi: IrtY: 
INVl CPYt I BiBMCt tf I LCfl«l I LDJCf ta JnP*^FF4 

9»,SEF tLClLIW*/?: ACLI J*0: tiTft{,4D: LWIi 7^: AX»Jr 3TAS.4 
E:LLhMBt. tt LCArt4Dl , ViflNlhll t- fff>*«q ME?ijq:LJirt2tBE0giji 
Ihvi trvae: Dntct : ftl 5 
IBBlS.gg LQfl*4FFj5TJM.QBl:RT5 
IBia. men LDA»| 7 I JSRil-FEG j LDAtl s JSfiJ.FFEt 
IB^a-D/i**: iTrL^DBSiL Tnita. CTAJ.net: I 0A«.^:^TAI>1>B[iiL FAif 

IB3*_D¥»ai . hw l.DA*3' : JERtiFFFEt LDHfiDtlB, V: JSHtrFtF; LDA" 
14:JSH4Ff-E-E:LD*»lJ*i J'SRLFFEE±| r CA«TliJ5Pl>l ! CEEiLDAfr.|]an, f 
i JiR*FF6Cil BO«:3.JGrtirp-Et*t.nfl*l JS: JtKfcfFEe 

1 1!4 BI.DPi *3 1 ; J fifii FF EP. : i.Odft Df B , t : J ^H &F FEfc 1 1 [Tl ■ I 7 ; JSH I- - FC 
E< LQAI32: JEfttFf FT£ 

1 «S0 i HY J GP\IJ iBWhH : L 0*«« t BTfl^rmrir F¥TO 

IDbB.npr LCYfUf: . Ty LBBB31 s JSWrfFEEs _DfllcUB3 T Y; jSRtFFFE 
i L RAN 13* CSftlFFEE t L DA«^t JSFH.FFtfc * LIMIT J 1 T JSklFFCG : I DA|r|> 
Bt , V i JSR1FFEE i Lfifl* 1 4 1 JbRAFFEE i . DA» 1 33 : J SR^FFGE 

147M.DA*3| UbrAFFEfci' natBas, v. J^fcr l*fc: LD*tl 17: JCRAFKC 
L. l.OAm .^s JS?*.rFtF! I MY I C^YtJ I BKhv i LDflr. i STft*.«)A t .R ff 

I KHfl.5E.E7 C_Ct _DAS 7?i p[):«MB: tTAMDl LMtr73r ABC* ! £ StAti 
IF- :l U>'#B: , tyl Ljn(',al>i , Y : ANDN^ | CHMMl DHEtf 1 1 ■ tM.LPVm. 

1EHU.-IIT I DflttWF:ETft^na. :KT5 

I IBfl. SCE5 D.r :L0Ali?2:flDCIti.4litj £TAitD:Ll)PBr73: ABC* I : aTlS, 
*C: .DViBs .MED L0A<fc4p» ,riCm2iF*tiH t. (kv , n-y»ie,tb«E* 
OiRTC 

1 I i«. Kir* LLfl* 17iJSF*FFEE tLDfldJUSMf FEEl LDflt J! 1 JSRH. 
FF6E J LDA»7i JERlrFFEE : LUPi '1 : JSRfcFFtEi CL2t t MtDSS I ADC«S: S 
~AfcBQS:C;HFii«iPXt^>rM:l t)im».;imp5j 

l I :b i rtt^LSfc : UDF4<DS£i : LMPH i 10 1 ^NC sHDvJ j I. DA Ml S" rtHD36 ( t NCb 
>J37!LOPtiOe7 jOfWaifliPWESHUHlJ L3fliflt GTRM-D57 

1138, a iOW LDYlfii . iHMfifl GLtjLBAviW. Yt «JI:*40jJSP4FFFFtD 
EYf 0»VIB,F^t SHIhkIA: ?Tk 

ii'B.urtm i.in»'.[a '•:Ts'.y.' ; i.D,nit,i mjiJ.7;:L[n»',jHir,Tii*. 

4fliLOA»i«>4i ST^felEiLl3' , r*'Ilt . *S LDA#2 , Yi STP.(fc7,2J t Ys INVl CPV 
HI?: f'NtOS: , YU LDAtrr . Yi SID ' i*l'» i Vi THYl Cr Yt*>4tfi«kV1/trt I'J 
! 1 i.1. h. 1 J RP:i LBAW31 ■ .-srtjfhtE: LDA*fl; JER1FFEE: LJMII6: J 
r;(fj,r«tF:LDipBT . m lvywi.vy tDA«i2Et JCfi^FFect jhyicpyii 

Sfl:BHCy T iIN)(ECPV>?:IJMEff :U. t:RTS 
. I fef>. its » L0A4AB ■ rjH^» j ifiEC«ii?t LH».* . CHF>ne - Bi Og* r L3AM 

i^TOL^F^.iMiijiSI^/fllRTS: .(if LDn*|;STA4.7Fl(H«ib?Sl5TAb 
7Bi RTB 

I L 70. of 2 l. MW-7F; U«F=«Bt*)F(1» qj ,D«ilO:%T &(,/(- -LDAH?-*«J5Srflt 



/HiFrRr * s LIM*J :9rF* t / l F]!. T'A#**StaTft»l78hFiTB 

I inn, bit LDA+17iJ5Ft,FFCC:LnA«l i JfiftiPhFF ! LlFM t 7; JPfi^F 
tFi L PA 1 1 Z I : J SFM-FtF : J5RHOHAN 

. 19BLDA»B:S1F(.FI"1 sHtAUHSJ: F.tnil,(reS,5ri.MI3J'iCUA*fcl IsSTft 
t r.-JC». ;iTf=-VL-L-i f bTASil'ii: l.i>n« I : STAt(032 

l?BBLOF»l3l: JlWf'FFlitiLtmtllfll.TaRlLfFEEiLBAdlBl SMWECtLO 
V»: .l:N LDft»] ID: J5fii,-f-b- » HYi rPY+_'B: LnJtuJ L0»" ".» : -l^r.F 
f tFiLDAWIi JShrl^FCiil lA*zvi iSnirrEE! Li>YtB: . nt' LDFiflliDU 
SPAr" f h 1 1 ] NYl CrY H?«kf PUtni: ! L DAm i 5 " AAT4 : STM7F iSTF^Hr S T 
fl^Ii.DnilifeaiFilfifcJT; 

l.'l«.PAi17;JSkf.FrCt;l DA«H'R:^5KFFrrE.ilIMlPWT.16ru.rrT;Ci 
l !W»:ji JRRtFFFE:L»ft*3] .JlHV I thLEflHf: JIM FrX: k rWBl ^ : ,1 
SR6FFCEiLDY40t .rtt LPAS.S7CP , Y* Jf?K(,FFt,tr 1 1 W Y: Cli°# I i : BUEr 
ta 

l?Sm.lin*17:JSPtrFtF5l.D*(l7:JShV.F»f*F.t IWT1. JHtiS-Frht; Llj 
M?|JMW l*Ee: LLfi»t : jaflf*FFEtlLDY»fc . m3 LTAi57Bfl* Y:.)5BftF 
FEE : IHY:tHF"» 1 3: BNEuSsLDA* 3 j j JR^F- FFr LM» 1 7| JSK'-FFFEi i 
DA* I B: JbiAFFfet :I.DHJ7i J S^F^EE 

i:"5HI DAtrjiTirAf'/Mil.DAIilr^TAtTli JOhUia 

i;«,*iit JSRdfi jyji^d, -.:JSHjfii f,iansou:i:i'ritPflT?2rrtij 

C#fatWlr*72iU»Afc73l WC4*lBTft*73( JSffkli *i IWCi-74ii D*V /1ri;n 
Pt34: trJFw»l in JtScff! ay: .l&trte. ay : .ISftfltl ny 

i ITiWLMi^i jr^'.riil , 1drAH,B5'J:nTH»Lt^Sl Gfft'.IT.7tL,lTA*(, | | sFiTA 
S.!JS9; Srfli354i ST(H(P56iLBfl*2i STfiSUSI 

r^ufLDAmtf &rA*>?4i .urdtp -■SKjniayi JBfidi »iJSR«niiJQMOJt 

C!.CfLD#*7?:Are*Hfl0i$rA*/2iLl*&*-:flm:»l i«r*W3»i'Jn iir-. ; i 
UCfr'4: I DA171 icri7« I «j »t DP {Jt'tt.EHta I-Vi Ffi!, fit 

IJ'aMHiflfl'.I.L.i t8TM083l6TA4{]99l ST4M)i7i .0A*tl I ;S (i 
VliSB r SI Ar.lt^.4 1 RTC^CIA; LDA> I ; SlfWOftZ 

t28BJ«tdi*I I DAaT^S: STfi*. 7P: I ltn#7i E tflH.' t i h. DAt 1 1 STA!i6«l .T 
*Hrfi». .uiff J^R(H>J«viJS^]1is:J5Rini : Jaft&OU: Sfr:ll>Av72sS 
PC»Sl STA V72i L0Afr7'.; E5bCHa; lTn^73: JttRdi t: [)FC(. T 4 : 1 DAJ741I; 
ff'ltf t PWEbJIt k tftTS 

tZSB.EEHj k [W*7* l>(ft'-^Bii,l>v»i.D..ji'F*ri-Fl 

I9BMJ 

IJIBNCKI 

i32KMjr>not: 

:(M?]l»-BiAT»' v i!.Dti5iA - i-/t>-B:7*I'55~A7.iEAU->.J:cir«i JF 1 t-r-si 
f.nur>«-B IHFH J3VB 

-■;4H]F MJ«P1.»2 fND Fl.rmm-] n "'— «Stfk-N >| «B>- LLiJF IF 
wuriM_-£ rtHr( ilomr"; FT.i»JH~l 1 FT-t-'DN- < 

J35ilr **JI>>-L -5 PHtirSTpVlf 

l3*H5OT0Shp 

1T7F«FiflS,i 

l„wai- y\ nuii^l T-ON P*t(NT ' ' "liAMf nvEK fl*1il"R [HfiF 
I-CC-OUI-aBgtaHExTl iFL't IF MurfL-2 AND hvett/l ,f GCtQI 
^4H 

lv"?«lrF Fir...*-? IUFH runt - "UrftL OVER FLAVFJR TWO*iF 
UK r* H FLTJBBB : MF ■( t : LL S 

14SJBTF liyeiClOl ItlfN 134B 

HICIT'^ 0: llrrKl 1-7:1 i^vi<2}=7tb«l l-a-t ( H.»^' u*KL' 1 =h ( 
|*=*Pmihfi;j-»iF4~aTHiWliH2B,"- -)*-pftCStNriN3 HJNCHY 3Y 

ITRTFiN LEVIS.... STAqRlMQ, „,,.,,. 

. . ..rHJAZltlOC-0. ' • .SND.EIrtrftfttDA. . . JITH, » .FULL. . .SUPPORT 
JN6. ..CAST..xDf...- 

1 l2BT-»-l-i,*'^sUlJ3TEfiS. " i &i* < 1 I -"BBSB" rScs (2. »"BflC8" i PLn 
tiia-J iMIW^-ItSTd I -|2StSPt2i -J2B 

1 43BEUt.LXrRl3 AX* ( (dX-1 ) / LSI t iBDt FK.IH-TAB ! I v 4 I ; "YC3LI HOW 
PUETSDt "jitllF'X'rAHl I .il i*OT TMt **/! WE OWIC* " JBPC 14} ( « 
■fil rLEHEMrS" 

t41BC3LUUftl!El:rRllfTFnFi'B r 15) ; 5THIN6* (^B,Cf-ff*130MAB(B 
, 19i i arRiHLj* f^H.tHfitlSB} uCQLULFftLISiCQl-fl «n 

14S0PftiM-tfi*(^,ai i 'rvmjit*R 60 7(Y/NJ"i:COLtMJR2 

L4fiBPR|N- lp-iB'B.17);rUttl (P* , r 7, ,2B I , lT7.*Tl*ll l^nt-UH T 

J47BAl>]|w;EVf tlB>".IF ASO"- TiFlllflffai 

>iaocurDi4ibi£ 

14SBIF ft#f-Y- 1HEM j« 
t5BBll- ft*0"pj'- lrEU 14&B 

it>iBcn.LM]'7rjL' 

1 3IBVI* i l7,lf,B,lB»Bii FRRTZ= L TOSSSSTErSs 5OUH0 I ,3, TR^ 1 1 
HatXT 

isaarfltMf "well Dtme >p!«---bu- hom iry it-'t«k»i it 

'3 F9I5TEW- 

1 54B I 1 vn £ PLnmn " I 1 VEk ( PLnutkl -t ] t Bf < PtfiuAl -9> f PLrik4.» > - 3 
BiFOBIK-t TOB: CALLsnurE:Mt XT : S«* (PLmim) »" " 5 FQ I iT=4TrjiBSI E 
F' l;Sr»:PLn.ppB!=Sil t (PLlH ffl* tS TA» C 1 'Jtfn* J 1 BltlC T j IF-r J«N 

;fmABtFPAeCL?:Ff!lhm IFkCU?, iflk j F5TR1-JR* (7,CHRt I 23 J : ; FEJfi 
T*°STrmPH IHTTAB< 17 , 1 7.1 j C1*(t 1 20: l MElfT 

3 54BCUL OUFI 2S: PR1MTT ftBC IS, Li ; r.H^tl 19: OtH* t 4B; CtU DUR1 i 
1 

1E70Eini LHOl'M 

laaflEwDKRfiz 

1 5<7BDFFPflO-:B* LtD«^ : COLUUR 131lFOR T X-l7T0lPlTpft |NT1 AD 1 * . 1 
7,)|" "7f>Ft(]B.R)3 y "TADfiA.TKlf- " flNS'T: C0LCUR17B:C0L 
OWHii^Firtt F^B(4, !61;i;HAtl1IeiAfHttt,lt> ;Ci*H| JSTAEtlt.Jt. 
t ; :HR* 1 ?fj j : FihfOfROC 

lit^KrraOCBCIIIUSTCCXDUrcliFRlflTlf-Bt?,]^! t -iinrtji;'. Bt) jnd 
111,1,1 , - >5S 1 FOFtC-»TOIBiai/l:HEJ(T 

1b1»»FX71,S 

lt.28Frjf!Ti'-lTfl4iPPlrJirflr!(TX,n,- - ; : T5DUMOH 1 , I ,255, « = r 
UFH>fllD?*B: hF » 1 , ; I nRG-j}m?flB: «^*T 

li.Tftt^li-.aki^filpJTTAm^OSIs" ":C«Lacofff!CALLMCh- 

eiScf CPLf.LimJ = ' t "tFfPT-4T0B5TEF"-l:Sc*!PLpMi™l'!icf (PtnijnJ* 
51 P* < I^!i BS4 I ; NFK T t ENP^PO^ 

ltflgcFFrauriftlliM^Ofir^itToa^rRiHT-Hsi;*, ixj iSTPiMi;*! 
II,- Ji!H£Sli[" Lrt-a 7I.DSB-1 ELSE If Ul-14 7»B3ft«ll?ai 
P31=l ELSE IF Ut-il ?WJ5iBi 

lAMKXOJRLi!9fPftlllTTflDta 1 1AJ | ' " TAb ("7. l/.j t " 'lnHIJ,: 
il5" *:COLCH»iaa 

I ASflCUL Qdft^ : FOftt St- 7T0 1 Bl PR IN T T AD ih , TX ) I CNR* J 2"? I flB ( 9, T 
t > ; rXR*l 2*TAB I 17, Til iTHRt 12<3- 1 hEJlT: EO.IXJR25 =■« UTT W ffc, 
h> iCHKi l20TRif7,fe] |f;HF*t7eTAB( 12,^1 I rHRn >* B: CM3r "i JL 

tATBDcFPirOCfTnFni-HiTnca^-GeT FE/tDr P.AYiCft -*PL«^r»i378 
B--HUNr;MY'iFrRTll-ffT04:fK?*57^B-TX'?tD5*rMri(T:CAl.l Bit 

]6Htl*FJ(7| ,3 

I 6?BFF;RTV= B TO* : F X "31. D54 - TK7Jl,^7Fa t HfK T . F0*n»na I LJ : BBO: ME H" 
T.RL3. EWRPPhUi: 



yOUR COMPUTER MARCH 1QBG 







AH='dLT J by. ; ..:.. i :^ 1 |T^lnv,,^r, !: ; : ....•■,, ■- :■ fed tyf ; - 5 !*M U* Q! U Gmol frttd taton) W»l ¥<*««« Tl*> «.w<r<= * n^Anfc Ic a(t> Qppko* kiriie^te o: 

It* i.u'ifiil ir**fr : " KB* pleas* AS* a t i;j CO I NslWesl C^tc'i 



YOLfl GOVPLTER, MARCH 1985 69 



■ 

The Complete 

Machine 
Code Tutor 

SPECTRUM 4SK COMMODORE M - BBC MODEL a 32K ATARI 




LU 



J 



Tuni New- Crfrvci.itonio imp lie miuny iw ii 

IrmvMicnw <* Code Monvlhr Cpttpi*«f1: I 
COle TjlOf iiuln ic.ir'.irn rruth(ri( (prfi umjiL' no 

Iju'. I be rtrfiu trf n-jcrti « ci<k" |> ^ yiiin nj m 



[?&;l«rif pkMj#~ (he hit l-CttrwVtrmi in KtfMi 
' Jr Wiiitnan » _ _ , 



ORIC AND SINCLAIR 
CQMPUIbKS 




OtH i cwauKii '(•k t»J fUUl »!H ftt Asm™ 
.;.ri4ni»rr *B* HM ItUO) i'Bfl CCP«0 On: 
Cblu* ftini* £iy iKI'l! U3t Sjwfcilr «w 
*,-,«i IV (lis il,l<VS4 Ll»I i'K*i-- Swi-lnr" 

'Tj- tump** 1 *■■** d''*s ti*i S'/thm <M 
dwpdi»r E«6 JtJCfti it. ri i ;r i»( Spitdum 

rtsju i*!*t*v t isi vsoi no s«k- j> <**« 

HHO«VW - lnl»rf™5r ■ • 4 CPtlKfcC* f HJi 
(I l«0t f M (Ma^n nrc Mitt CMmagtb t! S4> 
;L4: £7 Si.MiJu'i impin m'-f tiIiMtk* lot 

jBrqlryn E1K ;E1*| t1 IS fc*5 Dul'iJ --j 

p*. Ihm In 1 rull-nHr 0^4 -3*ivCa|. Fwf*f ' ijt 

K«>wjfr lot KMttfwi PU i£5J> t-t! PJtor 
huiUm ml Si* |(U| IGJ InlrrllO « (304*4 

rh.'i'i i?i J* immof/ i^wht ml i-m en 
SpKnun flurue ? »™i 3 0**jrt PI G2fi) ISO 

SUhJiuH Go'trimi-ii Hnlnr<M»r»t*fil H4f) 
152 tX prjlei IJ4 :-«ii ii,pH»-t-J i V I lib 
IW'U ''1 flSrjl 18? frSrlftlH' rals iiSalu 
«mi'<.i. STsLlur arAl[^J«l,iii)i.lJ|Iinit'9l ZX 



COMMODORE CGfVtPUTBIS 

i~. in i, ■.,:■■■ i IF-- S'.irfPI PiL' tlii iLm>i v./ 
CtRTiOlfirA PIlMl t3(B |C3B-1i n»i 
C»unwbrg 6* EiU ittl&t U3E Cir art« hj 

.*.»* "H>L DfltlWtV IWUUl-llHh inttT&Ht K>, 

Of- LMO irtrt ♦»» V* JO *™s r^ C*™iv«gitH 
fVB lOl Ll! iVQiin (nOia^ t*»«lt- 
tftMtno- i omDUAK ounti* "KimUk HI 

■ C.34 £<!> Cii --ih-^lfM* 4AB-JM4C 'L^&pJv* l-ti 
ll*4| tLU <<rl':»T iH*«Hicm ta> ^*cK! "Ml n* 
flnmi-yi-si fu ■ i"..eMror-ti tJtiCAll £*" ftSi'JJt 
n'j I'Lillt'le »«v Jitwi £I3J iUM(i f ^14 I'-ZO 
[niv«iipi;tl4i * 1 6i . l l J-il t --tA. U^SilU I MltW 
Hi USi W*= LisM phi iit (T2%1» 



ACORN COMPUTERS 

EiKtrd. El73 il1?9| v I'd SSC Mt»J»l S ' 4.1a 
ILIS'JtJST lt»niJ*i*m>l«-1'ni.»-|a.HirHeK*C» 
H'lUmlliSfiU'HHI Shfj Jjntiw kr (UtMUt 
iJi- :: liri^nr- 

CUMANOi DISC DRIVES 

^ ■j-au*^ i^V tpl«i<>:..ki til >lil- -Air J p^tlrmrn ^G'J 
O Uld VnlaotEni« S*r|i* HTnrtl -.I'qir ■J-T?d 
li."ti iCTjfti r\JTt. 4n i ■I.-* dtaijwP' ^npo aRlfi 
(CTtSCI! I- INK* miuI* -.irhh VWf rti«4| 
EJM ft! tram Ooert fktt* SiSfi* Knin «J^ 

Dt«t ** tuft *»mj»» iiw tswi t tea zta. n> 

HEh nn*V. t>W0 CJ« H-Kii' ->"i «n l»— -l. 
m*# M4M €»'? [*J.m FV* M) trJXJ! <lpp»iV 

nnnu:i.-i,t)i»:..L4J0. 



PHtwreps 




.«, u.?mm «l»v* tlM Cltl UMim 1R5 

k.it?pr'*&Eira *wi,»*ct fiPJ»r;srrtain 

PU« lir^ |L«1| EHt rpnn fW«r,T (Jl* 
LiJtW.i '11* tpaan I'M E3M i£!tPi itUTi 
CtiiKH'AJ iij|i-« prwlnrj anil >»l*clrii; Hfpt- 
*r(*,j EJ.-»;n*, faj HUilH, ElW B-.tnpr 
tM4 i2M IjWt *;«> QCr« On- Cclouf 
fHktle<Thniv li;*|llftltlil knji|*i- f run 
l<u mnr ?f '■» i ■". ltH>l V)C llKf F'4 C4«nK4)eirr 
U liS ?.!■ Ii i-Mi Ait tH nvvnt HkttftvQtlrivr 
i-v .itmr r*ni"i> '*or> Srixp «om»j*(e<s L9B 
, | r i- , s : , 

U<101 SUPERBOARU AND 
VIDEDGENIE 



COMPUTER REPAIRS 






v.-.H(i.» gr '^u^ir a«rv,;.# |M<1- I 



SWANLEV ELECTflONICS 

The Computei Ejpnrr Ri>f>nij4is1« 

Dept YC. Zl GoldsEl Rd . Swantey, Kem BR8 BE?, 

England. 

T*l: SWAMLEV (0322) 64851- 

{Tltctfi oiceti #*Kt>nn: UK pticjs d i> fsanr, '■;: .i'v 'ucuHe posl ai'ti VA ". Ttc 

utcovi {tkv n tftKVH* nt ft" i.*iKH Bi#rWn*W >" ' •nop! and wduttav ihsu.'liJ 

tuifMf ;rnif4jj( Tm iwo j¥ic<r f iff engott iiMiixtit.'vt iiwwff Fw^tfi* d'.'ie.'ijrf.'nj 

Ju-j-a'Hj til' .i.rj xi/hM vrjai'irri wwnr r^iu^t 



Tin pM ;1 upa l3 r ~ni i iMk '.h> jtdoi(.H-n (4 me | 
I le'S of r-i»t hn* i«lf rrofwnng ^n ;h( BBC M>:.'0 



Th* tsi* maspk-t cede tRor ind wi wious 

^p»Ct^*JTi ^rOCr**WT>Or Sfrw A I^ATf^fTUCiMnf «vsK~ ^»LIIj«11 r 

Ccu-1 



'h' BB^ ins Th« EfMMLH-L,n- 



Popul.tr CsilipytiriiWeekl* 



1 He* Om*';H.Kmi*ve joi i tert rati prnJw.thi.ri. K'l 
"id tlkwfrjfct om. tjij iotw. j*ntc tn:. It/ ih-jii|, y< i+i 
(1" U lft>il1 rrll <n.(-|i-#* iMiiii* t.ro^T 

Offli^t ip*i, »riiijn:i?k l nndci«e'l*»f:uic0 



i^^fJiftl -» m kii (oev ; »i pH^-^p: iCM^Kii iimthm! todc- u c iuy 
it she JO fte LiJpi t ,ii . Li*r tiA'ii pic« nd Ifttlljf fi jtii Kit 

mi,fo t jii (lULfcijitit rgnuEwsk ifou Imn |irojiin-.rwn| it! 
piokviorialiAjy. plL.tj 'tw triau al 1 1 m l i jjq* A.m. jbi ttvn hllgooJ 




r . .1, *Tj - 



^ 



/«! 



Software 



M«w GenerMon produca arc sold iceer*ng to ths»- termitji tnd« ind condtiey* nlsife. 
FREEPOST , B ith BA2 4TD . Tel : «15 3 1 6?24 



■<^rn&- ii u i» rii-rt '•I'lrrp <#■ ■:■* wi 



.TJtapi ! rui i«-| ;* 



Believe in the beat.,* 
its back 
on the street!,. 




*\^**m fli Vi»it 



[eCM55/f 



<a 



-I- « " ...*."^ii_ra*-v n*;»i 



STfLt SHOWING 

HAYMAKKrr (Minnie OXFORD ST. 



AND AL30 FROM MARCH. St ALL OVER LONDON 
SOUTHEflN-AErGllA-ANP aWTRAt. TVARfAS 



FROM APRIL 19 ON ftjUAU mOKAfmaA- WESTWARD -rOPKSHIRC 
TtNtTftiHARIKH -SCOTTISH- BOflW JJ AND OAAMPfAN TV UtEAS 



70 VOUR COrVPU-ER, MARCH 1985 




■**■ 

■•■■ 



11 



1 ■ 



■ ■*%• II" 



•■a. 



11 



•«■ 



^U|yi| 







G Barbour with a 
machine code sprite 
editor (or the 
GBM-64. 



■"S.K 



5 



1 ««ft 



a* ■•■ 




EDITOR 



Most Commodore gi users Ja have a Sprite 
Editor., hit ihese are usually written in Hasic. 
Svper-EdJicr is written completely in 
machine code a:id resides in i pari nf mc n-i tr y 
not med hy Basic nf sprite — VXKVi rn TiKlf) 
S-ipc r-Ed^tor cud be loaded into 
memory and left there oblivious to any Bisic 
ptogram It can i hen be called up by a simple 
Sys cummar.d when needed. This means that 
yc-u can progrLtn, cdir spriirs am- tmntimw 
p tog ramming Without losing your Hisir 

piogrtm 

Program 1 is :he ma.n program and mus: be 
entered, letting out the Kero stsfenttDi at [he 
crd of etch line, Tliese will he usid tn r hrrk 
thai the proRram has been COrritlly entered. 
Alter being entered, piogiam 1 nusl be saved. 
Program 2 must be entered while pnigram 1 is 
Mill i.i meinuiy. 

Nivjv typ<- Run ifHWi (In iVr jj-ri-^n ;vill 
appear: 20 J . . . fallowed by a value. 

You must check chat this value is ihe same 
as the valu; in the Rem statement winch 
atrreipmds to line 2C0. [fit is correct, press 
My kty itid the program will f»o run. o thr nr-jrt 
line. When all linia have been checked, the 
program will smp win an Out of Dais, error, 
K*rh* values do r.ot correspond, iress Run 
Stop indch^k ihti line. After corrcct-ctg ihe 
line Run lOflflO aj;ain. When a,l errdrs have 
been corrected, erase program 2 ani Save ihe 
program 

To activate the program type 
SYS 49260 



Yen; are now n me main screen. 

Oil the left af the sc rue n will be a M by 21 
grid, surrounded by a checked botdei. On the 
grid will be displayed the current sprite and 
shortly a fur thai a flashing curior will appear 
in the up left corner of ihe grid. Ai the button 
tight side of the screen will appear the current 
sprfee in normal size. 

Ir. the top righ hand corner of the screen 
will h* displayed: 

£> The current spite numbfr. 
(ll)Tha color of the current sprite, 
(iii) The type of sprite. M = Ncmri^l M= Mul.i- 
colored. 

The (lashing cursor can be mevee around 
usirg rie cursor keys. 
Clear will clear ihe 'rid. 
Home A-ill position ihe cursor ui the top ltd 
corner. 

. (P;riod) slots a do\ 
Spax will clear atlut - un -plots it. 
C will increase the color value to the tlea 
higher value. 

T will change the sprite type from normal ;o 
mulli-cilored or vice versa 
t will display the next sprite, 
- will display the previous sprite, 
Kl will dbpluy ihe menu pugi, 
Run Stop will re: urn you to Ha sic. 

[Tie Menu Pag^ will disfhiy flv; ft notions: 

1 5TORE DATA 

2 INPUT DATA 

3 TRANSFER 

4 3EARCH 

5 SOTO 



The computer will wail lor you to pi ess one 
of th:se numbers, I la 5. 

STORE DATA: The serf en will clear and 
wher prompted, you must enter the firs: 
sprite thai von wi;h to Lu l,jvl-J fullowcc bj- 
the last sprite that you wish to he sav*d. 

After this a sub-menu will be displayed ask- 
ing whether to Store 10 disc, tape cr program 
lines. 

H\ou choose dUc w Ian*, yov will be atked 
to enter ;i file nam*. Whin the eonpucf hat 
fhished saving it will return to the main 
screen, 

If you choose program lines, you will be 
jxVlcl to stipulate the ineai ,vhkh -o ttan ch-c 
data, In this case the last sprite is ignored as 
only the first sprite w.U It stored. Thr values 
tor t.iis sprite are slarett in dsta statements 
whic>i are read by the Basic read command 

The .1m value it ihe add.etr of the sprite. To 

Poke the sprite into memory, have a line 
sinulir tn: 

1Q READ AD: FOR 

I = OTOG2:ReADX;P0KEAD+ 1,X NEXTl 

Q(w In- (■[impntrr is finished storing the 
dit», it will return to the main screen. 

INPUT DATA: This fuictiuii allows you 
to load sprite dalsi into memory, Whfn pro- 
mpted, you must entc the device n jm?cr and 
it-i- fir nsn't 

TRAN'SI-'LR: Uw allows the dam fmn 

one sprire to be iransferrvd to another. The 

parameters that must be em ere J are the 

(continued on nexl p&g&} 



YOUR COMPUTER, MARCH 1SS5 71 



Progtam 1. 



I *-** .3= 

? K«»iiFi-ii>4im)r(cv)ri»ita»-iA 

to &»-*(*•:■... I K .*:.;. H ■ .n , M OS, ren *rt? 

'■> i>«i,:,i'i,it.^.?»i,i".| 1 iL" 1 '),r.tn *?3- 
2-?; ia'ai'i !!»,?-, 141,47. 7. i4i ,i3.:^[r ;tst 

393 DA-Ri + l,*!*. ',.HC. 15.:*, *+.3,*»HEM 199.1 
2Q4 3ft **h, -,* ,'4.3/46. 173.**,?,li'?,asifiEr i',i 
Vui Oft- FIT. ,1*1, 14, 3,: 73. ,47, 3, 109, 6.7 HEM H<SH 

7iln -fl-fl-i.Ul. 17,1.171.44.3. iti*,4,(l, .tR t£Fi 

247 nft T ftj. m, *•,;,;!*..? M.ana, it,, iiiinin c>4 ?l 

7*4 3A L A147, 3. 1*4, «*, -3 , 72 , 74 . 7*. 7* = nEFT :7;ti 

20* t»*ft7*,.'i? 1 |ii4.;*j L t*i,*t.[5. "MHilcn 7.261 
91* a* *>t. .ro:. i*,c:4.;fJ.o. :-.rjc. :r,= run u*S- 

311 Eh.TtL|43,S r IT1, l9E,i*,,3CB,.,7 r 3. 3^11. Plr* 96q7V 

=13 daahav. ;.:<+. ;. 4. 4n.n-,yj,i,;n 33*7 

.'-, . 1«|A), f4.2|fv?3B,,^,IZ'.I3Z.253.2L3i.*i:-* 94»1 

zi» mraw.iup., fc.j.^t'J.H.Ti.Siii.rMiMw .*•<• 

2-15 MlAl 4*. 32.32, 33, 33, 32 , 32,11, 32lRE91 133,7 

.711 eai^ie.li;. m, 3.1, a^.aj.as.Aa.ai^iii;., li.%,, 
21? BAIA|>». 62. 41,4*. Aft. 7"., m, 79, B2 I BEH 73*3 

zi* iiaiai ;, 72, ^ 311,1:?. 17. 32.37, 32[Jif>i <n . 

3l» OW1.-.H, ». 13.32.33.(13, 1,3, 1.3i**r 4U< 

7H- HVI1], 1*3, 147,1^01, 1*3.163, 143, 14.3. IAIMEPi 1133 

=11 D»l*.l 3. 3Z, 73,33.. 32,3.3,33. 37. iJlfcTr. 4*1 

273 UftiHCi.ss.SJ.SJ.SS.li.W.oi.iiiren .444 

227 EVHA3 3,37,4F|.IF7,,12.32,37..32.32,1EH jTTfl 

2L7i 2AlAl'..r.", <2- h 3r,33.33.3a,37,;3,lE;n ;42l 

721 j»Tftj'/, 1 iv,^!,j?.3:.3;.3:.32 siiiEri ;**0 

-.-■,-. n~ -.n :■ : . sat . 1*3. 1 17 , 3: , 33, i.1 , ii , 0.; I hu* JJi/ 

U) »>fl:1Al.3,l3,l3,37,3S.32-,3,Z,72 31 1 PEW ;33* 

221 BA74.32..;2.33,37,3.r.l7, 32.32 Til, lElt -4HP 

221 HAift;;.71.4*.»*.*3,. I?,j.-., M in,n.n -J32- 

3»c tAtlR.U, a, »3, 34, 12, 2te, iz 321 inn :* 1 4 

13J iWiALLr . 39 , 14 i - L J, >^| >•! ■ **, W- 3J « %■< I44B1 

IK (MiAiy. ijf. ,♦.;.,»;. ,>3.,M.i t ;., Y j., t ;,ii(n ,.i; 
.-.1- iwi'.iin, it}, 33. !?,(!,! 3, 13, . l.e-iCE* 1771 

ZH DATAB7.69. 413.113,3?, 3.3, 7], a? UiUn flW7 
SK Ml*J7,(l,V.»T.*.l*f.H7,!i,V n,'rtV«lFl 4404 

ijt t-ii'ii ►». s>. i«i. •-,-, .-111,111, is zm i6i'i«iti 3931 

277 DUTHC. I 3T.. 1 '-?-,! '.-,.'.■. 21). 2:;. 2&7.2SH, nth tiSi 

71E MTHV.iHl, Wtj.3-t.JS*. 753. 74. ,*>, 34.411*71 TSl* 

XJ9J 1HM.-|», 74.731. 1*.3,*,11»,]H, 141, J4HRTP 64j* 

21 : JMTA144, 144, 1 frt. IWi lit. 14A, |u, H.A. 166i**71 74 7! 

= 4i Lnlnm, 16*. J 44, lis*., 144. 146., 164, lU.IUlHn 7*70 

JM3. DA TA 144, 1 44, 164,, 144, 144. 144, 13.4, IMlDI* S431 

247 DAT*1ll4, lit*. 184, 144, Hi. 1(14,164, 1B4,166|RCP 6370 

-.-41 3 atai«4, i »«, 1 34. i U4 . i oi . i e* , j 64 , 1 si*.. nw„rt p« na Tfl 

24= DATA144, 1*4, 104. 164. 164. 164, 144, LI, 1 14, M.H 4*44 
-,-44 JAHfH44. 144, 1*4. 14*. 1 6*. 146, 144 ,144,1 44.FCFI T'Tti 
2*7 BAV1 144, IftJh, 144 144 144 1 44 . lit, , 144 . 1 44 , UIH 74T8 
tm IUMt44.l44.l44.t44 144. 144,144,144,41 MR HT4 
;*? 3»ini4O.0. 119, 1*4. l*i, S*. 21 1 , 7J31. 2ftf i KF TWv 
TM MT*fl>l,|., JVO.riS. l.r.O 13*. lMl.ll.lnn tm 
391 HVllH, IjHi, HjJ JJ.flfl,. ?M. J«Kh, tnn . f 1 *tf 4J4* 

*iM WiXifl*. ;»t, i4,'t i,-.,!;', /.n.Tj^a.zTi.zI'iwm o;ji 
2i: anw>2 1 . »■■ ?»■ i .v, tbs, . h, j-jt . 14*, n >. m J7js 

ISi «hln> «, ,-... i*-i. ,, i«s, liyrTU. 1;. lini,*tr 4«K 
i-ss a«Tiv.-»ri, j*?, »i c. Ttfl.Tis.no, i«, jj,stM IWi 
jji Lmrni-it,, KS, »*. J3, 1*4. 1*1. rt, Jli, 1 9"'i fttj- JiLl 
vr,/ BBt»2tin, Jl, L, 1, .,*, _,L,«iH£fl za:. 
2SB D4TH0,ti, 14», (i,1H, « 1H.141,*, llfn Silrt 
23* DAT»IM,S1,K,3,?M 1 70!, J , 2'U, Ol , 2»1 1 «!■ Tli* 
ZiO C^THir,, ltt,.'», 7M,>1. 1-4,111, 41. ItikCrl SIS! 
2fll MT4 1 70.1FJ, «.!*», 141,14, HI, ]?;, IlKK 4*4* 
Vt,l D«T*LV*, 1*1. 1L, VI, 1,«, lT4,44i,*lF*Er 121C 
It: [JlTai*«.li.(, ITl, 44 ,^, 1M. 21,1 7.", »HT 4413 
7*4 DAT-ae, If 4. 1-:.*. |i,. 1»i. 14 .«, 11:4, iTur^n -7*4 
i'*5 P*T*», (.**, It*, t . 14M. 14 .u. 1V4. 14,PEFt *T7> 
2ii MH, l+»,*^,V, M, 3« H Z4.1,7».Ji,»4r 3«4 
:t7.M11Wl|.l, 114. !4l.e.lV4.14?,g, 1CTHISI 4*a» 
34B [HHV, lift, in,*. 1*4, F4, 20, 114, 91. Mr 41U1 
24? K>niw» U. [*».J», 12,ri0.2^fL,.-™i,1'H!-.Htn 33H, 

374 tMnj4, »■.:**, *», m.rii. t-2.j-/i, i40(MH tiro 
iTi ww.itj, ni,.ii, :-i»,jM,2ot. MH.o.fcn <«2i 

272 iwr^rim ■.'+* iftT.u^z.-io.rra^i^riiiEn hm 
27.1 m>^,i.ui,»s at,, im;. ts.AT.tamtii ui-r 
27* unm:!,!*, 7f,BSi*iii:ii2,;-, .'i-iKtn i *t 

Z7I MH;;, H.**,t*,0. J?.3,?-3,J.-iflTT iW 
--?* DOT -,T | , I p. , mi, (,!!, |1i' H 04, 7», 85, B?j HF. n 3J*H 
277 D4r4li.ii ■,:', 44. »:-,Li--.B: ,Tl,i4iUE1 !*■[ 

27B c*i*i,7. ».<,. ss, ». 3:,i:.;r. e^bea zlid 

37<r D*1-», J?, »t T», ?4, 3(,fJa,«J, 3S.0VI K»l 

26:, D4rMf, Sf. <H, fln. 17,T-.H4.*.t, !2,iwi aO(.» 

TBI D4TK,,C, J,!.?*,**, »,>o, i^. Kid RETT 2*?1 

262 DAT*"?. '. ',>.t, 'n.m,,- , li». t*.:r,«i>i 7W 

2«1 D414;- Hi «*,«. W1.T14, 14-:, 1**. 1*v. 1*4.«JF TJ5« 

»* dkiau,. a,. «*,::, n*. ji*. iiz. j-j?.i ui«i 44*) 

34C JtAIAiU'tla, lfl*>, »4"4, 1?. 1<-T. l-*4. 44*J, ft*3i»ltC . »H< 
2flA Utl!40,|W,lt:, m>l*4,3.l9l, i94.l43.KI1 nw>I 
2*7 Ml-1iH.M6V.194.J7. US. iM.TO. 1*4. itliLWI SHU 

2BB T»t*!*2, 1*3, 160,194, 12, 122, 191 .22, 1 IttlMl %Vt\ 
2S9 BA14194.143, 1*3.1*4,194. 1!?. 12/. I'l.KlHl SSH 
2*w feftT41-09,l*^, ,63, ?01t, 1441,1 V«.S^, 122. LT4.lVn 4V»^ 
291 art1f*j2. Mi*, I"*, lii. - , '.<)•, U4>, 1 91. 7Q. 12!. 6(1 41*7 

vrt «*T*i9*,is.i49, t»4, i*j,;n. in>. i»4.;:!«i hi* 

2*3 OKifpilS,!**,!!, l«», l*1,143,2lf ,169, 1*1 1 f«1 3M41 

2*4 DflT*i2, 122, 1*4, J4, Ltd, 3=, 14.2,1. 32 J mi 1*1 M 

H9E B«T*S4p,B»«,lI'5,t.lM. 141 ,Du, 3,l»»,64rS S494 

2V6 D0T6C. L<1, 41,,^, "i',ri, 1W-,',171, 16C1IKEJ1 JiTS 

2*7 D4T4V,, 16. -, 1, R^M) .233,173.3 , l*11filT« ,»JH 

.'VII H4I4I1I, I.K., ;. live. 14L.fl,J,32i«n 1>U 

SM** D4T4V. ItJ. It. 1 **:, 19,143,3,32, 2 4«l FCM 4444 

3V« E4Trttaa, IT?, Jtt**! 4 4*1 *Ul 3, V ■»■'•• 1 (CHI 

I!K D4T* I ?3,*, IT*» 141 ,«, 1,32,6,1 ?2j=«?1 14* t 
1U lmll74,i*ii,,--4.i43.7,H,3*d.3ja, l»iMr 441* 
H>* mi*;, l'», Ji,lK.2Tj, 149, »,l*l,21lK£n »v*u 
3«d r«-i j.nun.J^iu.i, iisi'l.iJ" "*." •"■ 
i'/A ;iii*7. i"^ h S F ii*,i*i, *o,zoB,.ii.9,2Xiinin *«*7 

3«(7 I^H1*l.r,,-i1I,ltf>,.0, 1*1 ,4,?01, 171r«C"l JM* 

-Spil PA142, IH.Kl.TT,!*!*,*!, 149,0, 14[1K*W 3i3*1 

304 t41*2t,:o*,>»,231T h 193, >W, 4,141, IBilrTH 4>hl 

HO MTbJvO^iJ,^..,.,*, SIL, L ,l4l.,-V,l»J4!tMtl *»4l 



3.1 D4T434. 12;,*, 1*4, K»ft, 1. |4 1,1 >.l, »«■ IEP "74* *37 

1.? MTni.T,4l.l3H;.l,,»>,4.l]3.U:.,^:»/. »MH t^W 

3:3 qaTbi 1*1,4. |*4, |*|, 7. 1*4 ,13, I*,*t9 TSU 45* 1 

3 4 inmiTt,, 1*9,41, I37 h **,|** ,4,13s, 7C1REM 4 1"7 > 4Jt> 

Si 0*"17». 13>.14.,»4, |73j,|,lT4,|-U,71,ac!lT 34111 43-1 

3.* HTAI 4* , 9, 1 H.T4 , 140, i, * , 73., 3» ncn 2433 433 

?-t 1HT"iH,14,J*i,j*i,»i, j'jj.ii*,, ia.'.ji-tn -,,'f.i 433 

3,* B4TAl49,0,133 1 »l,l44.l4«.«331,73J,]77,i,l.n »»| T *3* 

I.f DtTA7l,.V,13*.19*,S4<J,lf2,*3,2j«j,244frEll 7140 4,13 

131U &*1 4] »9, il , iK , l, 14.9 , fj, 3 S3, 2B 1 . 1 491 RErH S'WJ 43* 

III D4TAl,v, liS,a*3, 1**,4 l.l.'jj, ."-3, 1&T, »1 FiEtl *7>0 437 

»I BOTfil 13,-7 J. 14, I ■*>,!, 194, 1 ,J4.4HHh;n 4J9J 4JH 

311 P*Tu-3M,i;2,l,l«0,0,l77,S9l,3!ei,ll1Eri 3436 43* 
374 .-:*Ta21G. B. 149. 164.32,210, 233, 7s. ;17iRFrt »JI3 4*0 
ITS D4Tft]>4,H4. 11.32,31 8 ,233, 1 44, I2.33rlWll SUM 441 
374 3*TA2:a.233. 1|4. 1*4. 33.31 &, Sft*. Villi, l'J2 Hin u:*L 442 

T77 D4TA3-. J41E . j J,. i»9, 1 J.^J, VI U , VW. 11*FPBlT>l TB?0 4*3 

ITB UTiq*,3;,?l4,3H,:*,143,23.|,in,211lflt 34.4 *4* 

379 D41A113.231, 1I3,33tf, l«a.A..I33.3-12.212,«Fn. "i.**} *43 

320 D4Tfi7-?4. VI. jot. ;»2. 144. 31,113,1, 94. BEH 4431 141*. 

3131 B*t»(>,L4l,lSi.194.l3*,72, 132,73. I7!|W* SlKki «' 

JjJ U4IA1». (44, 14 J. 4. 1 4H. ", I 49. ■>. 1 4 1 RiFI 3.43) 44V 

333 B4lAl». 1%*, 1<3, (»,M, 143,731. 7-». 172. BIH *<17 44* 

J:1 D4T4B. TIM. ^41.^4. 142-. SI . 1 (4. ». 1 13) *«n MI* ISA 

335 n*l*Hl, 144, 2,134.243.141, L 441,101, L76,Ctn t«*7 451 

■1* D4TA94. O. 1314. 1H9. O. 1 51, 251 . 149, 1 ?T„ ivfl 696> 1*2 

i,/ HISLJ.WJ, 119.41. Jl3.75.14*. 1. 1 l.,H.n 4v;i *D>J 

33B LV4I-4T1, !(■:,(■, Ifcli, Ii, 1 II, I i, 201, IMJlRErl 3ti"> 451 

33* D**R2iO,f, 169, ti, 145, 751. 74,240, 194: Rtrl 72C4 453, 

HO DATA!**, 1,1 IS.rSl.K*, 143,34, 1-9> F 111 ■ «rl T7»» 434- 

3.1 0*rn^i, 14-, *J, 145,44, 1J3, 73, 141, 741 HEM I'M 437 

f-3 D*TA1*3, 9, HI, 7», 24, 141,331 , Hi*-. 24, fifh 4321 45JJ. 

313 D4TA133. Kl, 14S,3S3, iUl,u ,1 .hj, TSV.I.Jimn ?*■* 431 

11 36TAZ24, 33, 24*1, 3VV, 1 73, 1 , 174 , 113 , 23.1 1 RIM 7234 4*0 

3*3. D4TA149,4,133,»i*,t44>.i.4,331,l«,ni;hl 4744 441 

HA B4iAj-a, j4,2^4), i92.«,::e. J4». 1.9.4. pen **3* **--■ 

3*7 ctlJllTl, 73, 149, 1-4,1 13, 71, 149,14, 133inr.lt 3*11 "43 

Va 94TA1,14Z,0, h*9, 4, 1+1, ,41. 114, .iMfilf.n *?k2 444 

34* kVTA4,|4, K 1,1*4, 2>l, t»,TJ,llW VJH HE n 3, fir" 443, 

3» Df>oi<;b, 1*), mi, t9v. nn, 19l-.ii, T00.rj9.FEK reas 4aa 

131 HT4I3B, ItA, 171, 1*1, t">- Ht-T?-- 15T. 17*. «E* (HVi 441 

i:: E; t ,-,'., ,6-., 7t, 1*3, ), I H, 7-1,143, T*,«M '3.2* 44B 

.V-5 D*T«ir.a,o, uJ,7i, Jif, 2zi,*i,zoi,2i*.pr* 71*4 449 

3-4 DCTftl 19.33, H33, k 173.1,1*4, 1*1 21» loTn tlrtr 4T4 

333 D*TA7,*», |TJ, 1, 1*4. Ill, i-M,14V9 Oi«f[i1 JJ99 471 

3!* Oe1 Ri 73, IE, 140,0, V. 7N ..Ml, 23Z ZIltEn 3131 «7» 

lit DfTfiZCO, 192 h 4,2Dtl,i'*6,r6, 2M.1.9. 2i5i*.E*l B023, 4 7! 

33B DfTm33,53, 1*9, 37,, 3 J, 34, J5. Sit. !55l HKK 427* 4 ,'4 

3'L? DclRiCl,0,Z0i,:7, 1*1,51, 14«,OS,23l-itEH 542* 473, 

340 Di-Tfl2:3, 201, 241 , !»}, 3+. L *3, 34, H,L ,:■«,»., i'l " ..'.-' IT* 

3JI (MTAJtf, 23*. 144,6, 177.1.9.71.1191,1 41., nr» -0*9, i»i 

312 DITfl** , 74 , 1 39 , 1 * 7, I kO , J, 72, 1 77 49. 1£H 1747 47B 

313 DtrA^t i,y«rj,i4is, 1 1. j-d 1,33. :;*, i, i.siNtn i,^/ 474 

JU* D4T*[ 10, 1 43 , *4, Tt, :o+, 1 47. 1 49, LVI, «J 1£*l H.'-J *llfl 

3J31 HTA41. 104,241, |4T.2*D. V., JOl.l, J« q >nr 4 «(, > 441 

346 49f 4-17, 7^.1 , 4^ 74*", -1, ,--"., IJ, 24*. T3. L4&t STJ9I "til 

3l7 OfTAM !,>-», i4(., ',4,,>l(.l37 J l*J,;i,J«|,Hr« 411) 111 

lit iwtai7 F 24a,3i,i4i,i4£,?4o,si,i?«i,i*irqFji sir* im 

LV9 OFTA24»,3i:i r **,27i,l»*J,*a, HO, l>7,74tOE» 61)4 4D5 

3» DATA3l.l*B.7*,l«tl*f ,7*, 99, l*H 1 7j f >4tjn >»4 4B4 

l/l Dfl4lll,l«,l6i"I.l«i '6, .»->,- <w , -i,94vn VMI* 117T 

373 ITAI72, 199,7*, 110. IH). 74,122, .9H.tiRCr 4172 IBIf 
171 Dcr4i: p H7, 1*7, 1*0,0.1.4.13 S43, 131, mr 5*3i- 4*9 

374 H=T*24>, 192,*4,34i.j47.T*,I32,:*4,.49int71 ?144 49U 
Jfl& P4 r A] IT , 32, 3 1 IJ, 253 . liO.D, 113,37, 191rREr 6I«* 411 

■W, TJTT4T.7. 3 1 0, 293. 2i>^ 3*3 .fl, 30a.3.4,9A.f.VF 7J-.U , l£ 

17T BATfl*3,ia r lg,4l,l3 33,4*, 41 ,73 1 RFn .Hl-,r 493 

37t 6"7AIJ4,74, 12-, 32,44.119, "2, 7|,02|REI1 70 1C 14 4 

379 D*T A43, 7:3 , V=J , //,31 **..3, 13, 6* I HEM 2973 443 

3S-> )MTA74,Ijg,,jQ,l3, IT 71.74, 74, 4U|KLM UK 446 

Hi 447^33.**. Ml. 4>, 44 *, 1 ■-) 1 1.4, k4«LnEn +r+o 497 

3472 DATflQ. 1 43, v* . 3 J. JU3 , : 4. , 74 I 'J.\, 1 9(1 1 lifn 61ir> 4*1 

3(3 •*TAt*9, IK, l*>.4. 4S,k9,l2,2tl7, I9«,nEr SUM 449 

34* DAW*. 123, !*#, 17J 7 , 1 94 , 2>l , 2< . 24*1 nlr 4514 Km 

hE WTVnH»71,. l lll,VV, l.>, 74, |0C. O. IlltEEM 4207 301 

T*, II4IA7H Jt. 114,7. 1*1,74 14* |97,»4.4Cf1 UK» 301 

V? VA7A14I, 1*7, 17!., 7, IH.fOl, _,21{,24*iBf, 74:*, 34] 

IBB ■>ATA?14..7. l 91, l *«, v *.i,43..6(.2ui.23A I H1' T3I1 304 

3471 »a-Vii-,li. M. 1*1. JO 74. 44, 91, IT 3, 4,9V 1427 . - 

340 DOT 01*4 . 341 , 71,7447 ZZ3 218. 4, I »4 , 2i! (HT 197J 144, 

79l Dfrr, lia. ill^, i**t, 41-. ra,^. ii-=.T*. lo^.KEr- r.r *,J7 

•'i. I^lfi|,,133, ?:-. IV. I 4 1. H", 1 '",4, J91I11 37.17 i.'r, 

5»J DRT (1201, I. }4o,l »>,%*,», 19 1,^1, 143.lF.EFI 1*11 V ".u-7 

394 JSWA6*. 21J, 39,133.*f. 1 "4, 1*3, 19B, 7*1 RE* 1 «iM 3tn 

3*3 tinttlTk. I 4H, I"), 7*. fll, 94,^>1.17. ?ii.riEn 3*4 4 111 

171 E-^TAr^Hn.i^.llv-. :j,J"l. I„jiv,.ll»l1 =4, / , Jl* 

\9 I * 04f»Z(il. 4S, 3*4, 3*, !41,4l, 2411.1*. I'illREp 4ml.l 313 

155 CJTA133, ;*(,. 1«, 7*. If. 97. '*,, 1 1, lUK.'T r * J ;» S i» 

399 647*7-4,74, I**, ""*, 1*4. 149. J,, ill, 11-., «[> f)*4 B |3 

4<4 DAtA74,14*,19*,7*,?,2^4,23*."J. 194IFEF 39^3 3| 6 

491 D9<i|1j,9,it.,iv|, t.,>4. s, liV.-iHl" 4JI* 5|7 

4433 PHIA141.3, l4»,l71,-;, )4., H . 4i.:.fliH£f* 34-:| ji a 

443 f>"tA24, |*o. 15, 162.4, 33,7*0, 2713, 11,9, FCH 4344 319 

*» DAr*jL>,4} t ;n,,rK. 1I,3;4,3»,:;*,14<|REI< 43* 

401 DAr^.17, I61.»,i:,34«, 2M, I 7-:. 3. 1941FEI* 4303) 

91A lin.44141,9Pf. J, 149, 11,141, (Jl|2|3ZlRErl 77 1 1 -177 

4«r r»IA0,|92, **, 1111,1*7, 111. 7. 194. Till (trill H>72 133 

*01 DftrftTB, J40 9. 1»», 7(. l*l,i-, 1U4, Tf,mE11 47*7 3Z4 

4.34 pAlAlil, 1*1,4, it*, 77, 14 1,2,191.741*4711 1777 323 

413 Dftrn232, I «*, IV 117.1*7.144.0.1 JI.j-liHITI 6*04 516 

411 unmi±,-JSf Hi ISl.l*+.l* , S,4l,3>r)S,:i3l*E74 i*4l =77 

*|J 09^76, I Ji 1*4. 2M,1, 111,2', IK. 73-iF-in "■:•' 1211 

413 D4JG14:, 4, -.2. Jlii, 213. It1,:.,.i;,,li,iwr ibbt; 52* 

*tl D4r*S13I. S3 31-tl, 333(3 r f,7lQ, ?*3, J*, Zlii RJ?4 TWO 330 

413 D*rRl*-l. ZOi. 1, 94,74, 144,3:, 142, 4 I PEW 4*4? 331 
411 MrflJ2. 34b ZfiS, lt9,12.7I.2]a,.2L-3, JJ.fttrr 410) 33r 

117 DArAri-,-, ,-;.. 'i,:ii...2~.j4.-.-iv.i74,jt7m£Fi 7iri* ;\: 

414 DAFfl'Tf.z-r, 2*, 2*,29,J9, :9, 21,2'lREK 13J3, Wrt 
41 1 r*rA29. 31, II. l.',«3,fl3.(O r 44.B7rR('F 111 ! 133 

420 IWA43. 69, 141. 7t,4H,3v a |V, y., 7? iFEFt 3J94 13* 
4J7I P4FA49. 747,471, 47, 1 1,1 J. 13.44.41 .REM 144 J 3737 
42" UIA^-Il.l.**, ?'.«,6*. :?,4(.43lR£rl 27»4l 13S 
431 bAIAU* .63, , : J, 14, 41, IJ, 71, 7f,BlliRE1 27uS 134 

421 TJAFAE3.B*,;;, 61. 6l,*14. 13. 17,51.1411 V*6B 1*4 
423 BAFA41 33, **,•:, 61. 711,11. 71. 6UI4LE1 1344 141 
U. EA-4B2 l.l.ii". 4l. JJ.4J. 14.43. •»,«*» J*»J »30- 



DA(647,"Z, II, 33,* I, 22, *1,T*,0»1A=J1 2744 
kiM. l.T. V, U, 1 1XL.U, 1 13, 1 49 , 1 1* . 3?1 *C71 99 1 3 
■ ml ■Vim i73.3,2*-^,20 1 ,■? , Ji3», 74TJ , 12, ; 381 REP 7193 
DATAZ-S 2'rl.:,2'f,24*,2i:|,33,24l> 4 IA I ; A:n 4494 
DATR3H5|.5f,;4Pi,i;,:-;i,14, 3441,14, Jin, ?EI1 I9BT7 

CAl*3i ,;*i , iz.n: i,v h 24": h i2,7*,4:mci *3i* 

nA¥*2O0,7ft,ll>,iu.l, I* ,334, 344,74, 14»1*E11 41*1 
&AI4H33J 74, 199, :o3 h 140 ,4, 1*0,131), 71 HE34 1407 
0*14131,72, 16*, 1*7. Xt.3li>i 355, 141. 1*1 ,M 9 44.7T 
C*74HO.',72 t l4*,0,I*l,il,3,3J|1,Ll 2733 
3ATp.i1, 1«Z, 3:. 23t, 2SS, 201,1), 240, 2I»|HEH f»14 
DPH20! ,BB, :»0,15, It*, LIU, - W , L*Z, LU 1EH 3t2l 
Bl13l2DB,215,ll,'1. 1*7,15-. BIO. 330. 7l, »6i4tn 61 1 
DA:l I'M ,1114, 169, 1*7,31, 310,353,71,, 961 REM bL Tl 
04 7)193,1*7,71,79,61, 79. 12, B3,li:.R£n 33L1B 
DJ;-hB2.-3,BJ. ;,V,33, 33,0, l4l.,UiJ>Fl 24* 
OAT* IBS, 122,2-^0,33, HO, 3tt,-/Kl,2Ul,'7:riEH 4741 
D4TI20B, 2*3,32, IV. 1 94, L 73,4,1 » 4. 141 r«EH 3717 
DA7tl,i"4,7t,94,1*l, l*7.t3. 44. 43- RET 4464 
BA¥6n7,H.3-.,FJ3,I<:,,ie,73,B4,6»|Jtl>1 337* 
1IA>43a,,j,<,9,74,4*,I7,ll, 1-1, 6J I RE* 3j*Jl 
DA¥67-I.H.44.1>,# t |47.4*.4|,12 l *4rn 23*1 
4*1^*15, -1,67,73,13, If, *1, 11', UlElM 2117 
CAr*t,3.*tr.lV^. ll,5l.4|.33,7k,73rAfH HT4 
0AU.7fl,4fl,i,, ,Tl,#a,7r,t6,**,«l*t« JlaJ 

»4T6o-i, (7,L>'.c. 1 4«, e , at , I (J, SMI Brrt 'V>K 

DAT 6Ji , i | », 2a3 f*P) , J>1 ,'VJ4>1|, 7*3 121 PE« 4726 
DATA12, !**, 171, 1,14-4, 1*1, 133, KW . I73--RE7. 7*59 
I HI I a , 1 14 , 1 »1 , I , I ** , 17 , 1 1 7 1 | F7 1 1 .5 I W n 1165 
PAT fe?t}l. 13J, * 7, 143 ,393, I 33, 61, I*', 1 3 REM 37B: 
BATH2 r i 1 n r TflM , 161 , Fl, ■ 4^, I 7 1, Vitt, >l,iEn 41394 
[WTF21 0,233 ,200 ,20 1 ,3, 201,2*3, 32 121 IEM 3*51 
4A7F 194, 172,6, 1*4,303,14), 1, 194, 17 1*131 3023 
DAT^117.;47,|63,75| t [33,73,^5,?53J, LSJiFlEM T'll 
3AT1 74 , 140 , n, IB-J, | »4. 2«, 33, H S, 2l1l J47J1 1*31 

ri4T." ?,-,,-,, -T,' ■!, -■9 n 7i^,77.-. , JB, 333 34t,4EM B34, 

DAT!4>, 2*>, 24», JOt ,**,3*0, I, L. »l,KiF4"n 31.-7 I 
ltAff24ir,|f,.Sn ,34 ,3*7,4, 7f,^),V(L , HE* 3134 
Dfl¥r74, 129, ZOI ,n, I Fl, 201, 74." 2 , Itvj, Ufrl 104a 
■MIFl4 7.ll>. M. 14.4*. 73,43, 77.i,*mL« 3313 
n*T4-iaj.^ r |#r*.7, 144, *,-,34k,3 2. ZH4-1-CL7-, -3TTi 
C4712-,3.21M>,2T.| .fr.JNU.J*!, I t.r. Cl,3J ,M1P1 S174 

OATe»7.23;-i.l33 r I-l.^7,?«3,34i.iL,i-i-aiiiri:T FII4 

Hr*z41, 1 J*,**, ». 101,301, l^.,-,7/ I69.RZ74 ZW- 
0AT41, 142,6,140,1,13. IlLi ITlTt 1 11*1 fEM 5+61 

r,AT41*7.FiF!, 1-41,7^17, 1?, 3 B9 . IT-i". . I*E,7T,FE6 ,. -_w 
EAT*i7a,lb5,74,1i6, 1.1,6'. 73 3[6,233|REM 6BBE 
!>Alpl73,Z22,200.!4l,l,lfl,T6 *6,:4ItlEH LT9B7 

DATns.ioi.jai.iss,.?:,!*!, I, .ii, i,rrr« +iri 

6A7A14V,! ,33,164,339 16* 13 ,17. ,2 10 I HEM 5326 
ft* TFL359 , I 0. 1 ,163, lO, 1^.699, L? , L 3" , 3=5, PtCI- T34I 
rj*Ttlii,I,7.1../n.l«,74.1tl.>*1„47,;3rH!n 4FJ66 
.'I*IAV , 1),. , J33.!73,MS,3IM, *t. ,L*',7tlHEH 6233 
□ATA94. 143, 61.63. «4. (3,0. 140 OlMn 348* 
3*9 Ag D5.,fi 6. io-l , (i , 5 . 4, SSS. 390 , zui , CM6BH f+c 
DA-n:4iii,z4B.7j,, IV9, 19.641 »i- i;L73 . 1 69 1 ret* *4B4 
■Ml-iW.lll.l4t. 167. I i 1*1, 119.7, 14 liRErl *347 
4A3A120.2. 94.63.49, 61, 0, . (tf>, H 9X4 29»7 
MKU B3.2T>3. !M.!:,i«, 355, 37*0, 7* I ,Otf4tn ' 3 1 * 
OAFHrfB.; 471. 14 , 1 13, B», 3, .111 , 6, 24*1 FtEfl 3413 
04V.T4L7 , 3U. Af k^i 1*6 , 46, .7T, 17 1">, 333 rPCr- 1733 
f'.T.^i. H7,u:,..4,s,fl.,*7.»l.71. 71JIF 7*44 
DATA! 1,32-, Ifc I-T , >«, »'. 32 , J^ .* t«*> I9t3 
OATAL4, ■:■, 1 4C-, r«. 1 41, 7 , 4 1 , " ! , 212 1HF tSSfi 

4*7A|ia,33,34-,3;,3i<,,->3F,,3f7ii,^ii,,i F FEr vni 

1A9 1*144,6474, *J>, it f 1*4, |73,4, '"if^ijcrtn 347.3 

CATA73, 17.1,1,144,1.13,74, 16*, \ 47, 7P r RFM *-F7ll 

-^l J . i- ,ZM, 1*9, 17,33, gl*,23», 33,310 lA MI 4444 
MTA135,17S,I, 1*1, 11|,»ii,3. lil.4=REn 4'j ■', 
lATRllF+jlil.ll.S 32,*. 197, 33,,, ■■ i'-; "1 449S 
■■,, F6tV4, 163, 1', Ilk, 1^-, 4, 1631, ,IJ, 14] | RET- *45I 
I-ATHTl.-l. 57,1, HF7,1*», tl, JJ.ilCi FEP1 47J9+ 
>*.r7i / 'W34 52, S. 247. 1*9,151 , 14 1 ,(H, 3i «E>r 4S4i 
)*■"*( 69, 302, 41,1k, 1,."2,<, l»;,7eiREl-: 377*7 
7A¥«lc1-7,70|,7+, 1*1, 77.143, 14. 133.71, «"n 4t>ll 
■rfImB,,., l.-:.v.l):,(i. ,4.1 J'/,. 1.14 I" 32171 
SAlA|*t,M, 3*2, (4*, 1*7, M, 211,233, 149s FrEn 74U 
3A¥AI 7. 32, 2I«, 351, 17, 7IO, 233.74. lAl. REH *H; 
7ATAF3. t». It. 133.73,1*3,74, rH,,L.li - ITS** 
.'■flTi-.l 7!. 74. 1 ,3>. n,14l,H,S I 1*3, 7+1 REF 426". 
MiTlil 4 1 , 11 , I 12,4, 1*72,32,273;, Ml IPEH 5*09 
J4.Ti.i6fi. i, l7'.i,7 14 1,4*. -,. 1 4V*,F>, REn «5| J 
'3*7*141,. Jl, j 111. 77,:2, 13,317', 1691 REM *721 
MTAI*, 33, St*, 231, 14' , 144}, 2«-, 204. 31 IRITN 1 77 7 
5AT47D2.K4). 77t, . 77 ,47. S 4 J . tF . 3.32 , I4IJ1 4t]i3 
7llT"117, 232,21, Ltl, 6''. 1C*,0, 1 73, 671 REP 3FJ+1 
1ATA14S, Ul, leg., ti, 1 13, 46 . 17* . 30 . 202 I REM 3 1 13 
)* r R.'Ji , 1 42, TO, 2+1, 144, i:,33,'3l0,233lREP S346 
)*T*SZ, 3, 202 1*9. 14, HI, 10, 3, 169 [REM 4*6! 
3*74703. 141, II, 3. 32,4. 191. 74.337 ,Kr 4V7I71 
)- rr.ro i , I ti . •■. , ;■. i- . .■ . i r ,i ,-,'*ti, i a , 221 1 ttn *19 1 

JATAF, 2+*,*,*+. 143, IM^. 144,4, 14: .REM 3347 

hWl.fif,^, l*\74i.lT».«;.3i>o,i4i F RE»( 7M3 

:*l*l , 1 91, 74.14, +3 , 1+ ; , I * . tr. , 631PEF7 4*7 7 
.l*l*'B,«I,74.**,*3, li.ai.WKEIlPfn 3291 
3ATA73.4]3j,4*,3I ( i;,4.*4.14.3:.rl£n SflJFl 
3*l*<*3,«»,«2,71,*4,*+, 3?,«.C.1I1P1 VI 19 
MTAItsO,4, I03,6V,71J1, 12,7 10,253, ZOO, FEU 73061 
lATfWOi, 4,3141. 2+1. 32,17. 194.173. 11 REM 47*» 
DftTRI'14, .4k,Lri-i-,244, 173,4.194. 1+1,1, 143J1 t9«iA 
3«Tft14,l£, | |7,l>7, Hi. 7-1. 13?. 733, 143IRE71 tli* 
Dl>Tr,:32, .33,334, 1 4t", L , UlI, F7B, 2{i3 , ZPOl REM 7M7L' 
DATAI2,3.B,fHlJ |M l,,o i ji)») 1 24ri,33,IJ.R|-^ 33HJ 
Dfltn.94, .73, I, 1»1, 1*1, I, 1"'*,. - i-, I UlRE-1 4 71B 
SATll.i77..60.«,13-. LT9.4. 1 41. 7-1 1 , WSfU 1471 RF>4 4 • 11 
BATHi.*, IB*, 1*7, 173. 133. SM>. ill. 1. 1 »+l «t3 1*44 
pArRi|,.1 t . it:, 1 4 1,74.74. «3,4f, 33 I UIT 3374 
16 r ft.S, 6>, 66, 73, 47, 4«, 33, 33, : I REM ZOO? 
DAT*. 60, 4,1(73, 10I,3»3,2'M, 32,2 14, 3331 1EP. -111.1 
1ATA201,9, KH], 2+1.33,12, 1*4. LAV. 1 (.1 III 9. 4B.-4 
»A7AJS,2.0, 3TT, J!, 14k, Silt, 132, 142.8U1 1EF1 .111, 
ȴft.40,:O7,:,3, | in, 233i 149. I.I74,0|BE.1 Hit 
■A¥A.-94,'.40,1, 37.1*4,331, 144,0. 321 RE71 437. 
HT4U13, 735.74, *|,|93,e,e,e,£lHCI1 2301 
IAT+4-711, | ( (.A. :44.,A, ->44.ll.')H.^.i> F, utg 
lAtA -1 



(coniiniAed fron previous page) 

Wuice ijjiitc's uumber and the number of the 

sf tlk where the data must be placed, 

SKAKCH: This allows you to •dot 
Lbroiigh at) the spiitei in mtmor y ut tltid tint 
y«u ?re ookJog for. In the top left comer trie 
number is ti^i/Layed uuii i.u iIk luvvcr lighi 
ccrncr. The sprite. Pressing anj key wi!) ad 
vtnet to ihe iK-si spritE. Pressing Spac:*, allows 
fin: rapid setrching. Pressing X returns you CD 
Main Screen. Sprite will have a blank for its 
Ipltc iiuiiiL-ei. 

GOTO: This allows you to jump to any 
Kr:rii.i; in the memory. When you return to 
main scieen, the sprite >ou xelcciect to Goto 



Psoqrair 2 r 

50O0O FL-20C' 

50OLO C0=J b fiV=0iFORI=0TO8: READAt AV=flU+ tCC* A> :CQ=CQ+l * NEXT 

50O2Q PRINT"6-lNt M JhL; ". , . " \ AV 

50030 PRINT'^C/ENJCC/OMJPRESS" 

50040 G£TA*:IFA*«""THeN5*i>0*0 

500t>0 FL-FL-HlGGTDSOOiO 



will be the cotTfnf ipr-ic 

Although the program is very lengthy -ani 
will take f long time to enter, you can be sure 
there are no errors a* each inc is checked Biter 
being entcret. IF you possess a machine cede 
i nini Hit — such as Supefrnnn — yrm ran «jsve 
the program by using the command 



S "iOITOR'.COOD.DOOO 
Once savee, it can be ouidly loaded directly 
into luemory by 

LCAD'^DrOf,",^ 
IF using tnpe, subst.rute 01 rur OS when sav- 
ing ind 1 tor & when loading. 
Hippy cdiriagi 



72 YOUR CQVFLTER. MARCH 1995 



I 




NowAmstrad 
gives vou 

over £100 

to play with. 




*■ Hon it * * Pilm aM<i .m I Bif t* >v 




CPC464 

complete 

with 

munitor 
ckifcacbttfer 



Free software worth over £100 is 
tine name of the game. 

Atong with your new CPC 464 
(colour monitor or green screen 
VDU) you'll receive a software 
starter pack of 12 (yes f twelve) 
cassettes absolutely free. 

There's something for everyone. 
From Roland-on-the-Ropes toEasi- 
Amsw ord word processing. 

That's onegaad reason for making 



revision for cxarns, cataloguing «nd 
budgeting, 

And it comes complete and rcady- 
tc-ga, 

Amsoft, A Ion of software- 
Yes. How there are over 10<J titles 
from Amsoft and independent pub- 
lishers, And the "ist is still growing 



Arcade games, edi: rati oral nro- 
Amslratl's CPC 464 your new home grams and business applications - 



computer. 




Here are the others. 

The CPC 464 coir.es complete with 
its own colour monitor or green 
screen VDU and built-in cassette 
data recorder. (Optional disc drives 
are now available wiLli CP/M* and 
DR LOGO* supplied as standard] 

It has a typewriter-style keyboard 
and numeric keypad. 64K of RAM, 
32K ofROM anda very fast extended 
BASIC with real time features. 

And it costs a great deal less than 
the price of a comparable system. 

The CPC 464 can handle the. trick- 
les: computer games (if you ear), 



they're alt designed to make the 
most of the CPC 464 s impressive 
graphics, stereo sound and process- 
ing abilities. 

And with Amstrad's speedtoading 
capability, even complex programs 
can be loaded quickly. The options! 
disc system will load a game in 
around 6 seconds. 
When you feel die need to upgrade 
your Arnstrad system 
to disc drive, just send 
your favourite Amsu±L 
i cassettes to'us and 
we'll send you back 
the same Amsoft pro- 
grams on Amsoft cisc for just £4.% 
per cassette, the price of a blank disc. 



Join ill the fun, 



Our CPC 454 User Cub is a must 
for all owners. 

As a member, you'll be the first to 
know about the additions to the 
range. Hardware and software. 

We'll provide vou with your own 
privilege card and send you free, a 
year's subscription to the Amstrad 
User magazine packed with pro- 
grams, features and informal ion. 

You can enter competitions for 
valuable prizes and keep up with all 
the latest An s trad developments. 

And with the free software pack, 
we think matfs pretty good for 
starters. 




AMSTRAD 

ONI GRiAT IDEA AFTER ANOTHER 



BOOTS COMMT Currys 



John Menzies 



Dixons 



USD OTHER 

WHSMITF WIGFALLS WOOLWORTH >^™ 



STOKEt 



"C?/M ■in<l l*R MXY.I anTrtde Mark* of Digital Rtwrdi 

1\ like luKii'/w umj t dwout the cs tiling Cr*C 4G-i complete coni|nitt;r STGrtCtn. 

Pleascstnd mt literature ri^E a vay 

Amuh-:sS 

Xtsrot'EB 

To: Amsirad Consumw EWi im es i*].C. B'curwqejd House. 159 Kings Road Brentwood, 
E«MttCMU'4EK 

reiChSCOkHECTAJTlMiOrtiOINtiH! ?RESS.H0TAX1 STORE* 51 OCC All.hEOD rCTS. 



YC7 



■ ••• 



First World War Aerial Com! 

Fantastic 'Point of View'Arcade Action. 



neituio 3-D action msk&s SENTINEL the most realistic poM-of- 
rgjtrw yeV*n avq- played Ycu'ro on j si *rsMp command 
l with the iate>t ir* utl'a- wpft s I k ato d computerised 
InslruTterteton. 'js-eitto naiigiila through deadly asHtoiribelrA. 
destroy onemy ?i:in 5 and <ra c k Itisif ba I ■ ie v.i rs thro ugh 
inlerpaleclicmmaiio.ds.Aiu igi-iB «iiy ^014 II dock and refuel, 
its tough duly bul you 'beamed th* comma mi New cin *ou 
prevent mneny forces frfcln capfuf iffl your norro planet? 
lyoi* hands, 



1&H&3, 1 



f\ 



'**&&** 



Zjl 



•*Ai 






ATARI 



^v 



1 -*^^ 



' 






'*>&* 









not 



SELECTED 

TITLES 
AVAILABLE 
SOON FOR 
SPECTRUM 



****** D 'sk 



^ A U games 

£24.95 



us. 



^Ssii? 



f/a 



. •/*»'V fifir '#**• 



IjMi 



Vcu're 91 the consols lontile 
World Wi?r t dogtfcfhtQBfn*^^ § 

fi'nyi' dc^n «neuny plan-JS. 
bomb 1 argots, slinlo Lanka and gojn emplacements- there's cona'ani 
aclion an the Jntn&dbPe 3-Ddi8<jarully jcfalllru BtTMfl. A1 the sanltr* — — . — 
tuie. you ha«e to keep tract of sMtrude, spfled lutf and d*m*g». 
Medals Jon * cfirne easj/. Vcu must master a aarles of flying s*ill? 
and perform thim wllhpln,>olr.t accuracy. 0n9 slip and you've lost 
~TbF -evsnyotr life. Happy landings, ace! 












Commodori 64 and Atari. 



-\>\ 



i% 



^A<€k 



'ir*' 



■'/'"■•'ftaSaVfl 1 "'*!. 



if - 



SSSSat* 



^f-~~_ 



^^ 



FJi*, 











CASTLE 



CRFRr Castir ["OR Oiit Aimos ii a 12 
scrrcn nbifur.iis mid laddetS gjme with many 
diet ere m obraelea and hidden hazards .0 
ivoid. You have been thnwn into thc 
dungeon of the casrLu and you have to escape 
Hy rt jdiiiig, cht door in the (05 left hand cor 
ler of each roam To htlp you escape you can 
nove Lp, down., left, right and jimp 

Five lives are ftiven m the start (fetch game 
plui Die --Klfii should you complete all .2 

Wr«flT, Once (ire; acrtul !)U:; b*c:l completed 

you arc awarded a .lumber o'poinls depen- 
iidfc on how long yau toot, ""he Escape key 
:m\ be used to end a game at tny point if you 
arc feeling duickaL 
A record o," tV.c top 10 iwikw is stored 

mir.imjm lOOC points — withthensneaftbe 
scorers — maximurr, eight character*-. 

To entc" the pri>g J an:, first ype in li&iing J 
and save it on csssexe with: 
CDAVE-CA&tLE ,AUTO 
Next, :ype 
HIMEM7167 



J$Vfig 2. 

|0 rKPUT'Siirl ac"er««» f'S'l« tpl ' » 

t 

3H PR[NTi11D»CHEX«(n) 2); 

3S iN^tB* 

40 IFBt-'S'lltHSa 

5» POSDl UOi, ■ -=H 

S3 *=**[:C=C + vWLl »'-Bt» 

7B tiUTC'JO 

tiB KRlNT 'CHECtfT. 

3» rtiJNr 



iIjl-jj New i.nd einer :he mflchnc^ccsk loader 
— lint in J 2, 

After listing 2 his Jt:t:i niicied, IVPC Run. 
The code ir listing 3 can now he entered M«e< 
by block, To do this, in?ui the sun address. 
Then the nutiitieis widi a picsa of the Retujii 
key between eich; enter S- tmte l bUick has 
been completed. To help de:ecl tvpinc error J, 
the nachire cjde loader Ctlculates toe tout 
sjtn of all I he by lis in one block which can be 



compared with Lie number fii^en sn ihu end of 
each Woca in th; lUting. 

If the am r.urtibefs a»e not equal, then thtre 
is an error and ibe hluck will hive to be re- 
entered. This method of error detecting 

yldiou[>h no; nfiillibfce will uncover moit 

mistakes. 

After the whole of listing 3 s ftnisted, tl r si 
ly, well done, and secondly, position nhe 
Cft&cJtC directly after listing L and enter the 
following; 

PCKE4608C f 96:CSAVE"CASTLE2",Ai608G, 
E471D4.AUTO 

PC KE 69 1 2 , 36.CSA V 6 CA3*" LE3",A& 92 
E30720,AUTO 

The giuic ii now complete and runs 
au:omaticallT on 
CLOAD-CASTLE" 

I see ikj icusmni *bj the game should uit 
idso work on lb; 4SK Oric-l but il you hive 
an ArmcM then you may wish to record the 
"crtor irriorer' 1 program, printed in the 
manual, before lisuig 1. 



Listing 1. 


M Fss-rei? 


m ntmmtici 


* . 1 # 4 K 


■4 


tW H*UJ Wit" >"I !■;*» 


.- 




]fl* rsirTsrctei ■ mi ■■ ( • * 


l- *lr -U--"- C«Kl - ■ 


7C *XII 


13E "-.r.TGri_(i. 


4 At | 1 III hit I 




»)(-.— -.■ ■« ..u.-i;ifins" 


-is , I - v, tiTW^B^nr^ if.'iiF-. itfliiLC 


^ 




mo ~ "' i ■<" ■: t- : ■. s :•■»» i » »■*■ i ™» t 


■ 


9*r*: ■» m ui tii in i 


nc "«:ht- 




»■• 


■;»-F'i.t.,li" ; .• .1- .i.V, 


*' 


LSfc 'P NT9CCS 


■ nt i in irj i t 


Htfl P«|T .-■:.''.'-■ >l,l«r< a 


i*F. I 


122 MlKKPtlll * 


t »l. 




b "Vli 1 ! T'Jr ...f" 


- .. I tiKJ 


■ 


:bs m HTWTMBI 


. . i . * - * 


JrK rei»T i-*f(it 


■i ■>■!*■ 1 B;,HrU»J 


tta "■iiNrifLu r t •> tl* «i*t *•■■ 

4 ■ 


1?J M Mr.Tin 


i ■ ■ Hi i i ■ 


(*.is;i ng 1 continued on pays 7 9i 



YOUP COMPUTER, MARCH 1B8& 77 



iBSFsmm 




BU*!EHK JB55 

:5:5s 



mEHS 



HfiHliii 



!8B"» 

ma. 



MICRODRIVE 
VERSION 

cvoiiabte f*' 
t/onsfer onra 3 

—lUi Write awn (JJE^er 
I programt f«wr. 





■"■nIHFS 



MICRODRIVE ■■ 
COMPATIBLE ■■ 



10! 



jw asgssss - 

1 CL 



10 

&£ Is 



S. £* 



ft 



-£• c- III 



L 



H T N 




sSi^ ..,, BE! u«ii»^«ff3f*- r^ c £«^w?l 




flfcta k <rC li M ad Ontf gWg" ^„ t -f, T , ;r g, a*v* 






i 



n"i). 



complete * ti W"w - «* p * ; v .,„. «.,,*« 
igeoiro wen-w ro ; j ■ v^, i^r Leu*'- 



TT^TT,. curing ioi ■ ll ;- '■•;.; 
^.fh tort*"** ^Wwo' *fl5toni !»" » "** 

THE»ONlTOR'W-*» fKdl||ijra ^ l0 

/ND... LOOK CUT FOR rHE 
UGHTKN6 COMMODORE 
SERIES . 



I 






t>0 







M. 



i 



B I^SB ; 



i i ny ^ 



S* 










(Pstiag 1 continued tram page 77: 


3-4 I'.jje, J-|tJ^*'l)iW«ll 


2;1* 50MH.t4kJ 






M'* UUNPli Ult< :GLHLI,2iB- I Ik' 


Ilfl W!*I:»r.Hr* 'CHttHJitCunUaltl 


IS fOSCBISH 


?:» mtirimtf 






jaw MX? I 






114 iH'iiM 


;-» trsciwuiiKMaM 






3tK(- KifJH. 


113 ftf! 4' 




i*aa fi fwi \?)+vm*\fi- >hm 


iiV# ■-:*- 






4HW 1 - Ftkr; . i-MMD . -.; i l*itM»">M 


m hum* 


''HUC.VJ' C!Uir«»r !•--. - 1 


i-ati i j iiui' 


K*a KpiscTiisa 






4«L» OOKEJl"'Mll,*K''M 


*u » 




IMS kk« -rit.il 


2i*-Sf>-: =if r-M'H^wj 






«efv jwc*7oeH. ttU3 


133 WW 


■.h*(*:ij: icL'n* ■ -*,- r 


izia r:3*F-tfr;n!«* 


• i ■ •-. i .i : "£■ . 






-S» tBHiMBl-'i'H'.B 


kit* 




IKZI lUCin- 1 tiKNJM* 


iWlt VI J> L . — 1 " 1 ' ;■-* ■ 1 




"ate i^«! ■/«!<«, m.:i-jn.«-<it"jj"i,i-o** 


«rt Wrji*' 


--Jury* -BC.-» T r law* - i 


•-■II 


1X3$ it'll 






■TWQtWC 


Ait- ' 




jkWa FH 


il** PLD".B.9i J- I ■■■ .-, 






19:3 KTi*f- 


mm j«iv 


-?,>*»', J J J «Cin«t k» ■ I 




2iM rV3U, Ll.-y*. *T* rcy 


3 irn 




*sm r3n*'?M!.<r:j3 


* 




jswa a*i isb 


. ■ 






■11* :6K£l*<«',tL>* 


»a ■■ihp 


T,I*BIC77 Faui kw ■ ^ 


il« IM Ci '• .*>.«>.li . . ,,r. - -in ., 


M* "jjiti -.111- 






.UKti^t«^,"C9ir 


j-.i 




i 1 : ■-,..-.:■: i ' . 


i}y« 'l.i. IH, ,r, -.'Hill M«t jf 


»t-i 


iJU J €fCf«4S 


its "pshi 


Cf*NF*(7 ■ ■ k* 1 


i 0=» J Ii* 


■ 






l»,W l»£1 tl H*lf 111* »* 


rl gjLY» 




»S riljttWit- [tWClllMUM.lttJI-'M 


SIM ": GS ] ■. 1 U 1 7 Jf* I *" :i*j; 


i=*|rl*- 


>"■- 


14B4H ^MKfl,«.l 


279 iJXQjeae 


ilM Kh* 1 


■, i- 






19S1I •.<*'!. « If.'ps-t:!- «£ 


itM .l: ■ :>■* 


3:PC*t*?W,J»"'Ll"lBJ , JJ.Ji 


. i 'H r! ".. ' 


i»a 3e--Hij-xjrt<n-«a3J kei-j-km 




ltt» MM) N.OHlh- jfiut^niw.ij.'i.e 


r^u- ^Kl'1 i,l>rH«l'll l("Mhl'.#l"»lr»' 


;ija &cijBj*(i--- -i ■ ■ iiw 


BBS l*-<*rr «!'.., Si SHfUHiM 






RETIDH 


J Ft '..'ir'A 


HAJTtKS Or nc C*$tk£' 


MM tX - w. ><!■*:*£ «26rt. 19 ifliWt HH'J>. 


J»7 ir«C(."(i)<-i:?n<c-<:r*t 


- nc 


?o«» 


lirdM nsc 1 3,1* JI 


BHpttW 




1 


fl TttlTi IBT^TTtTiI fTIIH* l~1 'i«ll*< r lCt?lQni 


lie4IJF0«:-l'*'J< J JiKKE 


'JdJ PftlH jPtiNT 


::/» fLjnu.U. -uufl W«- II OuH" 


IdftM 






!<«-* .►vcitfi 


jig f;«i l 


cia 


ijsa k-!n» 


3)10 H*-**«jVl ;M|1 J n i 






:(«« »-* i.!*,5,5-.i.-«,[.^.5.M.f 


1 1 n PtOHrS*! U,niOi« Ittl 13 1 -■; 





»« :»^uiiM,''yiHtH-««4i 






■ Mr 


j» ;i-Lcr*<f 'B«»e*-' F 7 nws.-««iM< I 


., ■■ -1* -a4MrraMai 


AH IUtfl»ttilW1l*l»« 








1 .i:|.IISHl|h [| JJ, u 






31= ,tlotc,j.(»; ciet'RMJ'l JhV'IJ-'» 


. t>,-.l -.. „- „(,..>, . .4if 


*"»i (■ *i*>»s,o»» 








■ 


VI*?,-..-.* 


MTC «*": 


3»ia -QfH-ira-BCSTE'Z 









Listing 3. 

KNtl-lCfB 

tih M 5 J OJ IV5 » *S* JJ « ft/ 

H f, a rt J) » « M !) « *; 

-. i e.2 10 m -tr 44 ■»* ," m 

«3 » « J! » >S 30 m « 3* » 

* S 1* !J :. - ■ .-.. . ts « 

■'* »M I4»| »»Jt Si 
>E I! : '"HI » ?J> » 

I 1 » * O n 'ii ** rt 

19 6! « PL-, :a f,f t-* di_ tt, 

,* M »3 fl? ?5 M fl< 11 » IS Prf 

K» d4 s" 1 eft tc « -j *> » in 11 

III iS il 5b ;: il :" . 

m hi tt si tt n hi ii m si <i# 

P« /3 ^a ,'A i.B 3: Jd 6 J ~'i il 11 
- ■'■ '7 »J i'J I ' 11 Kt t[ 6 r ?1 

r* ?o m &l . a ^ 9* j? «l ?i 

B ?l ?9 '.4. :* ai M su ti 8 99 

r, r..' ri7 n-j 14 /1 qs ^1 ■.<■ t- '-' 

;B J ' l" 1 B? ™ 71 ?c M ib 

'■ ar ?? as jj ji je t* » » 1* 
h •? »*| ;a as 14 k«i t: f*, 

it St >• 49 W » i3 » H » M 
» 21 ifS 241 » 24 M ?3 :i It » 
29 21 2d 28 "9 2* » 20 :0 2* J4 

/a ,-i ia ai js >i » ia ai rt ?■ 

tj$ :i n H » *f H M M N }* 

M«)IIIll»ll!jlIJfllH 
m '1 Id » 14 *l 11 H 12 J4 » 
;p /■ h ;» 3 n u ;j » . 

Jtt it )I M H 14 7JI 71 ?fl ?} 32 
H *B 2* ?fl ?» ?* 711 7.1 'O 2* 31 

24 » H » ?? J> Jft Til 'n iff in 

!-«»»» !» jun » « » ?J 

;j Ai a ill » .') JO S !S Jt « 

.11 Jl ill Ji- iS J.- iVf 2* W It W 

n Jl :VI' 2*1 /W !** » JW (• 4* W 

rt Jl JO if A" ..' A' /■! ;* .-.■ w 

H K M 7! a 3 jm M £* J 

29 39 ?i IS 79 711 7>1 71 It -- .1 

is d« 4t i« ^« ai /n a m a j' 
» .a « *e 79 7g zfl ,-n n m sn 

29 :a it 28 19 39 Zd .'« 19 H 1<& 

29 '9 si :4 78 aa 99 7e ?a ;i ;e 
n ib ji :• in Mt -it l* » ^j ii 



a wn*> 10 « «# w >i 

W Sa rll U« K. <NI IM hr 

;hccx- i*-K 

9ft en r} 3t H> cv an *. m ot i - 

ettJ-tXtOtt Hti.jim.kA.-i9i 
09 M »" it 9' L.i -I ' M 0*1 J 

18 9f ID OT 19 B/l PI U B IB 0d 
90 If rt 91 99 9F ,(■ >i«i «M || 

w ot iii (• « id e. w h ai u- 

.-' tt >>l ii « K ij K "' » /i 

i-i «i (.' u; » (.-« 7i hi n in *; 

ft7 *» C4 4k «f S* £9 -• 

i--t:.(i i7'i 

KM 

u 

|] 

iMtl - !«9 

»i tt *) « W U t) it i' n ia 
umiai l? ; r tw n* ru n • < 
II I! HHH-DM-I in)*a 
j*a uu ft (M 41 "(J *• «i 13 in A 
:«j 14 :«i 14 ill la git to i.i p° 

S"l ID K 3. tfj ITV M *r ** Ii I.- 
«9! IMJ! <V V.- 9 IP S* W 'H 
IC « *i *W A- WJ . i ■ i* M W 

UH M I) II W«J" 

i>JHt7-i7«. 

rt K «J » 9f « M If I9K *a 

« a* (F4 W kli H Hiv^i.- 

w m ea aft it It J9 99 ** pai »ii 

n is ii> bi a ji ic bi x lp jp 

fu ir. in m n it :n 93 99 .t d 

*l M I? gr Ai K4 4A !»■ tli li > 

A Ml M A! M Ml l! ,- 94 4B if 
JJ « W « M H »» M M III 

it tiu iv » a h » p> 

tutiH- ItSl 



21 » 2t 29 il 39 


79 .-IS 


29 


a: lie 


pi, <-« n H 42 as 


|] *3 


U 


02 na 


K 1* ■.( » M * 


m 91 


r 7 


,i B.- 


BO *T 1 C m Xi tj 








CKr*. ;«7J 








rf^t.ir.-t> 








*» it rr «> m «. 


31 »f 






:■•£■-■■ «i 








<,j»**:i*o 








B» -4 H It- A4 «« 


W 






LMCtt* :m 








SIMIDMU 








ntt ti n 








«j-t:*- »2 








CTMT'inS 








H IE It V « 








CHfUK- Bj 









I* X ^ «l 1> JW A> M W >f 7« 

Ki»}tMI3M«HK;. 21 

K b « W M tt » » a Ii In 

^»«tglHHilMl3 
Jf t| «< » V » *" " 'B tj 2d 
26 F ■ BI Pffl ?n i'P W M 



2« 24 
i.I-i-L. 



niiwir}*ka« 

6? *j a» «e « *j i* il I* a* rt 

ta H H SB 19 I i H 99 >fl » « I 

a* aa « M 1f It H 91 M 4* w 

ai -.11 10 ft W ■!« 08 a? 90 44 K 

U 111 Id (• DT IM M H H III li> 

HI UU Hi <t S". H M ■ M IB II 

IH UU UV W * 9V 10 KIHHM 

2(1 t!i Oil li! « 0* .rl )l M*« 

imM«,i ii n * tt 

CKCK- |H.b 

SPRT-7KH 

S* » 94 14 Uv 'M <fi* IU it 99 *J 
iM aa i-a uj i= tn «« t* LL irti 92 
2. II N IB II II H It JJ Ji 90 

at 2: 2: Hmtunniiiii 
It II fl iti iii ija tin iid ti», i> 2i 

en** iii iii m n u tit ii ij 

01 99 27 El «■ IM 11 VJ 9k 99 49 

k ta 24 » j- 33 j« -a :- aa v 

■Ji -2* i-3 J-l ill *1 VJ n 



S:nf-lEE0 

£2 I* 9i 95 90 Ii *! Bl *3 M fl? 
B « 8' Ji 93 ■*-■ *1 B-i IE £+ 94 
99 19 9' « 99 « « 99 94 (9 «t 

W *J 9» 99 99 I* K 4 3 99 H « 

«# 4S 35 94 « » Of <m 99 ifl it 

«t # M H 13 « III H tf M tf 
i» « J« M !» M «k **i 99 Ii) E> 
j*i il ill mi .»,! u in wi nil hi ,-v 

MilUMHiaiH n i a «-i jv 

.-in 111 II m HI H IH IN H 1.1 w 

n» K Ii «8 fT 

j-j^-jr* u*i 

Sr«T-?l99 

51 U «l 89 4S Jj HI M M «| « 

£j in a* w i)7 »/ ca HM im «i j.: 
&8 »9 a> rja W *n ■» uft t» w ** 
iWt -«3 6J Oi; ou at r.4 Jtlt « HJ *>■ 

M li 61 W Ul n ltt M US Ii* Ik 
ttUlftll- KIIUHMHI-'I 
lUWIIIIN-IIIIMHIItK' 



.... .11. 
.■■>. 



ItlW'SH 

jTA if *3 2J >; W « ?7 !? M «t 

i .-,■ m; .; «« « M 91 
>i « n m jhi « «j » « M 

.".s 2S /I- uu a*> j» >* <J1 99 9f 4S 

30 ?i il 99 Wl HI We «S 99 iJ 2*J 

99 » 24 it DJ 91 4» UW »U 24 /*■ 

H i» H l!9 « 91 Ik Jl «l H IN 

at Qi itj ja w) es eg h <h ih jb 
ItHHtlHtltliT 

■ - - 

«mcr«imi 

2Yi ,i ft" 7f 7-: <n an JC K » 4« 

2t ;(K»;ri«!-'*'?i(i 
a: I » » ;p jt a: a H K M 

kM A. c. «W ■*»■ ■ « rt- J^ j-r Ji IV 

^ „' «. 99 M ;c IF M Ml » M 

9U A) j- MUH VMMIID 

iw ji; tn kill <ni {fl ;f .r HIMM 

I* l.i .!* K9J tt **l 111 JD CV BB OB 

9« 111 « Ii IH .if Hk ■'- 
OttPi- 334/ 

B*l }B M JP JH H H TV JM kit V\ 

2T IB 91 99 7P IB 91 IW JC t* B. 

39 JT 91 99 19 > Bl ilj W .1 iJ. 

« it ;r n aa i* si #i >i 3d sc. 

II II J!N« i| JI 93 « il K 

U U 11 13 II H » ~9 H II II 

,i! «,i in nil 9a M LI :Q US ->a «l 

l ft. all m an uu in ji i: 19 il HI 
iw in J! J2- j j w 11 IT 
i-HC-n- 777H 

. .>'-.-C« 

iIh )i. ,> ; ...■ ,v » »«3 ii a s 
« rj «» w .1= i- .u j.i 'f 
Hnliii»K N m m m n 

l« IJ I. w w » -I « » W H 

w /j .-i uu im * « « « :i ? 
kf4 * a: 3» 9i si *m aa aj :i J 
«artzz«ii*a"*7i ?i n n ii 

l< Id i, uslN 3S H pim-n 

I 99 )) 1* » M FF FF 
CtaXJt* 717* 

t-'ii i . ■■ ■ 

IE- 64 *• *"< w ffl fp i' ti ifl ci 
« « W ti 3J i^ B? (S »1 11 B 

a.' w « <; a :* u aa k » 9> 

<jj «a 99 *- j j M Si si .v m> ■» 

tt i 1 ; 3* » 

n^ea i$ j*-*i •>?• m atM i= = 

ijo j* h,i ,n« i.,i .>,'i in .p nn mi *■. 
■ 1 M rv n* ftpi rtft ' c -I* fill afi m 

H HI W T. i-j IN II ^ 

.1-111- .'l'.-i 



I L . .1 

'iTffiT-;* 1 " 1 

Lr 

OaTCK- 21 ) 

:*: 

PS 
Bate*- 2J1 

ii+4ii*2if: 

C4(Dli «- 

TF-«i-7itaQ 

^L S VI IM AMH W 10 II MM 

iii ii. iiu uu .FJ ;D M » 3: *uv n? 
to in in- tt) iti ill » » es Bfi an 

f e IE ] B UW *T ** a-jr jH *) 9* t* 



IIM)t>ll4K 

:k«- i 1 1 

EI«T-KlilJl 

"-J 30 II 14 -HUHI Mf K Ul 43 :■ 

W 43 92 4. » J9 99 8' 90 «J « 

3-i-ea (J 4i 7i ?e is M 

tMC^-tH 

iiJj»i-aH» 

(9 HI -F 9,' il H il FF 

t*: 



•; 14 9i » 

jTitr-ats* 
*1 at FF 



-- 



StJIJlT-ISTJl 

*i it 92 ic. rr 

C1ECH- 35. 
S _ piRT-:9a4 



STf?T-»99 

91 92 91 4-9 39 »9 92 97 h. 

99 93 92 Bi 99 )3 93 B4 B7 

» 99 S 99 91 '9 3) 99 II 

rxo-- 32it 



M 



ii «**1 is ri ei c: 'i >i 


, |- 


31 




U 43 9'1 91 ii M M 94) f| 


*| 


m 


if*#-T-384* 


J-j 99 *i 14 91 C* IS IB FJ 






H 14 12 14 T 


r-H-i.n.-- in?. 






o-rae- »i 


■t«tr-i-Mji 






^ tW ^^tJIOfl 


99 22 « IC 92 X ft 






pr,mn*ft 


n-u. -1- IM 






t HICK- MiJ 


iwai 
«i UP II 13 "7 91 01 as 4? as H 


4it*i>:ii-4» 

tB 07 f } « t> IW «l * * M 291 


rii. 
imrttM lit 






» «a fej 44 « f f 

3*11 



C e? J" 0* ilF B? 



»fk IK. M Mi F7 SK 

iHer.i-« 3is 

trpirowa 
» e* e-i ii re 

UhlBII 
■rncei- 4t'i 

HIW4KI 

HI .T 111 7C PF 
I HI.. I . (J J 

iTW-rto 

H 

r>eci:- Ji: 

ItM 'Jraus 

in 

ITltlT'We 

19 

"HECK- 13 

llWf.JJCC 
H 
«£«- 2 1 

I 1847 
» 

ETiW'jaCI 

- .1- 

4-p*T-3*iC 

IH 

rw7( 

STUF-i I ■ 

Pi 

CHFfK 

.- 1 ..- 1 

ti n It «»!""r*ii iii m in 
iw i j « 4; «4 :i 44 m ar, 41 :a 
jh ill ft 9^ |i a 34 44 rr 

a*ew iwj 

5TWI--JM9 

17 HHillkf 



STi«To-iin«i 
IM : II 97 II F' 

*m«- 

-{TpWisIKt 

fJH 9)11 tit 49 W! *4 t4 9. 9tt 92 99 

Ii - 

Q4JBCJ Ji4^ 

E.r^T-)CjJ9 

Hi FIT II 41 V ** W >ii- 91 64 iC 
aa flj 12 fl. (} X ID l> U Bl *B 
3t IW 15 B? Bl CI JC 94 ft 

CH.Lkl- iSiii 

tt-4rT«IC44 

n« 14 ■■; n ■- 
3JD 

in04 
an Jt •? IT FF 
(ICCF - 

*i sf '. F rr 

1!33 

I I".-." HV 

ar .it j'j :t. - ■ 
r.rr. 

51«HiT--ii:rj- 

.'- -- n: ■ . 



0-jinr asH 
» n? fl'. <B 
as fn ii.' i i 
JC ee B3 i4 n: 



:u 99 95 m i i U m 

11 ID K H H II 14 
i-p. IK " 



V P«I-JL--. 
:: .: ..'. H rr 

STURT-INJd 

7 : PJ» J1C I* t-F ft* 4ft 41 «7 113 44 

?: -- ■' 



il Ii PF 



•TMT- 

uj t/ in «v a? » e: fl m « » 
n k k u e ■« « « k » « 

Ol K «, » ij n J| M (3 « '* 
M fl 93 'I 

■ J »a 



r r'*r-wiii 
.-:■ K n 7H ff 
.'4tCF- 

5T^U-31E* 
«■ IB il 16 n 

:■!::■■- jj - - 



sincr-Hen 
m ;1 42 .3 ff 

CMECK- 36. 

iriiittx3eHi 

H JE « t *T 39 49 It »i IC t«S 
44 F» 
CCbc not 

Str*T-3CO 

,- .•.,--—■(■- 94 H il I ■'" ■* 
Jn Ji |J IJ ft M »1 !" 1> il M 
S 44 I] T4 83 B4 FC 
tiltCK- +li 

*Tp«T-:it»u 

f. 17 Hi nu -J-. uu Ui 32 91 nn at 

(9 B3 90 ei PiJ it, WM ITII fit 

-c 99 *it p.; Hi w % W r " HJ P»1 

Eft 3C » iff 

I'iFX- 1E43 

(listing 3 corfinLed on page 80} 



VC-URCOMPUTEifl. NARGH19J35 79 



(cantinitetfirotn previous D£qg) ■» •* :■ *■ '* *» » ■■ fi ** +7 



1] J pa ■> 


= ' 


:<fb' s» 




trj*i + ir*« 




IT «E PJ fl 


n 


C*C EX' Hi 




•rMtr-TjEta 




It . ■ g: • 


-r 


Orf O ht, 




'tWllt 




ii ;»« IP 


■ 1 


Cumf- 117 




•taht-ieci 




>i" ;i e: li 


"F 


in, i.e.- :ti 





itntt-xn 

It |A 13 Ml «MM*I I- 
£MTtlc. j*jrj 

i[ FJ H| 44 ill JP«]« |1 |t Jf 

:r 91 03 4. <(][ Uh ■) ji -i 
:r h «3 n it ft v U I. 
:««• uTi 

IWI4FH 

n»i)ki(Htt»Hnit 

".HHn- 173 

iwti-yrt 

;i.'>«/.ini()! in J- 

yi7:iHIIU;iM<|l 
t>*KK. Ill 

'iptti< , *«» 
■ i it to a 'i 

I"" 3**4 

.... IV ;| rr 

Mine- in 

f» H II h F* 

CrlJti LtJ* 

iPK4m 

n it at m it 

miLn 7*1 



trwr-iNM 
I: » ii ii 44 

~ = I 7. J t* 
• *■ 43 Pi ». 

DAM' i'«i 

-,rj*fti« 
V tft 44 l» 4ft 
U r 
Qt.PI' J** 

B»rt«t 

it- mr> n *F ■ 
IXC*' Ml 

en:*- mo 



MHHt! 

:* ii m iv 



bl *« 



14 40 K K F' 
Mi** 9*1 



t,iA4i« 

■ HHKF' 

c4*ae» 773. 

UWtolB 

ii *3 ig Sj i* 
II MM M H 

= 1»- 15*1 

Hp*Tf4.|ii 

41 »7 H K K 

k « *: h i7 

C4C*- -■! 

fl*4T*Ptlt 

«K«KH 

• pn n m j.> 

tunc* 4«l 

t,-*»l 1(41 
*• *-> m »tm 

m — m* «•£ 
a»*4 *7 *- 4i 

NfiMrr 

n • • 414 

rwrn i c* 
Ft it 47 toff 
we*- **i 

'.*li]U 

H » » H fl 

cucir- Do? 



M 13 7.2 H 

"i ■« »* u 

It 41 Ml P 



17 •* i* n 



J 1 •-'. J -I 

H 14 H II 



M K K •» 

HHIII] 
HB4H 



-I! 4 1 

11 CM 



it 



M Hi 



I'HT-m 

II J* II 14 1? W AT JIT Pi' «* 13 

n 43 u ai a a ii « r n m 

« " 'J » »: itiHii 
-•far- ijth 

EMffiT--l*4* 

»-, ir « ic rr 
1-1:7- it* 

strAT-uiit 
h n n jd rr 
city.- S9J 

•..mi-int 
c « 1; ( 11 

'-[(■■ f»l 
3LH» T i4il» 

t u n it " 
o-:ti - an 1 



l'«t'.i;i» 

"hi: iwifi^iii 
» ' ■ n :i Ii 14 h 4H 
f« :t ■ in 



It *• 

rr 



13 •• *J tt 


:i 


C» 47 H rr 




t^f- ]»4 










',ltr»j»» 










» K «3t 


■1 








tmcf- »i 










^•VTHSH 










W « *3 I* » 








04!1X> aej 










fT4l1i43H 










*4 .* tV II f 








rt*»*. **< 










l*m'-«w 










H » » 34 f* 








(Km- an 










itmt-ii;* 










in » m ■ 1 


» 








EWHa * I 










i.i^i' «:n 










rr 1* M in 


15 


::- 


n ff ai 


EJ .T 


hi :,' ii Fr 


1-. 


t« 


»l 71 


Ii 31 


!• '( 19 44 


' ■ 


<i 


31 l< H 


n 33 


■L ;i II fi 


■ti 


•>- 


■3 1 1> 


t. 91 


■ 1 -f lin 


B 


k i 


^ M 11 'J 


■ [ 'E 


ii j ,1 1 m 


.-1 


■ 1 


3^ 1 Ff 


fi 41 


* '! 3 0: 


3: 


,i" 


24 4 1-j 


ll .'1 


*l 'I 11 H 


E 41 


■4 ri 3"> 


II FE 


.'l«ln' 


34 tl 


1^ « rf 


M F4> 


*a 4i /* *i 


i: PI 


n i n 


n u. 


it ti k *: 


T 


71 


tl 41 tl 


■4 H 


3* tl F£ IB 


J 


• '- 


■ 1 I* tl 


U 0: 


25 ti -J-. rr, 


33 


•1 


-£ 11 If 


11 tl 


7+ II 75 11 


•T 


11 it ti ri 


14 tl 


IS t| |t IB 


11 


•3 ai ." ti 


15 13 


<-- 3 :: j • 


-' 


-** 


• 1 35 II 


'[ It 


1 1 »i »■; 7-1 


»; 


15 ti ir tl 


1 ae 


c-E a e: *; 


'. 


S|i 


•1 n ti 


J5 r; 


ft :i 13 J= 


i 


(4 


4/1 75 tl 


tt 71 


mill n 


*•. 


3TJ *■* H 71 


If t) 


.■: n ?i :e ,r 


' E 1: 14 ai 


II 3(4 


»■[ » t7 


V 1) 


45 4| rj 


II tl 


Ii 11 ti j» 


IS 


t: i : 11 to 


II tl 


h£ H -t m 


an 


ti 


71 IT «. 


Ik PI 


21 11 *) tl 


IB 11 


.r ji ■■ 


11 Ul 


,-■ ". >l .,' 


* 


H 


Il It tl 


:* ti 


J* 1| 7t tl 


9 IJ 


IS l| H 


11 n 


ji": (i »j m 


n 11 


IT 41 71 


I! ^F 


41 « 4J £1 


0i 


1 


■1 IT PI 


ri u 


77 £1 34J HI 


It 41 


91 41 tl 


11 51 


Bl »'■ i'. r 


il 


1 


■ 1 -■: i>: 


11 pi 


43 £7 M ^ 


U 


:.t 


11 ., f 


It tl 


73 IJ t- u- 


U 


.'i 


II IL 74 


ii n 


4j r>ni H 


FI 


o^ 


■ J Cm |j 


tt »i 


34 IJ 74 1; 


H 


e: 


35 tl HIT 


11 F| 


»1 F 1" II. 


H 


n 


H ■: 76 tl BS 


4j 1M Ul #] 


f L 


>i-j 


13 31 11 


,1 11 


IE n 13 3» 


•' 


• ■' 


?L 'E H 


«■. II 


*; 9 ii 31 


9l 


.> 


>- J- l| 


13 IL 


'>' k j~ j'. 


M 


• ' 


13 3J II 


. Ft 


mn ii » 


H 


:■:■ 


Ii K 14 rt 


Mi in 34 


.^ 


:i 


ll 71 IJ 


vi t: 


'! C 1! «. 


.' 


7« 


H ;: ti 


* rr. 


fl=> 17 »[ 34 


| 


I; 


11 '1 H 


*i Fi 


IE 31 11 Jl 


P" 


:i 


J, Ft II 


« ll 


IS 31 tl 3* 


4 


.-. 


1 Jl J! 


"1 It 


a » 41 V* 


■ 


■-'■ 


« 'I II 


* « 


41 7* tl 15 1. 


" 


1 ..■ n. 


4* t* 


bi a *i rt 


1 


". 


ll 4.1 H 


It » 


ti rt taar 


* 


pi 


»HII 


tl 35 


41 JI «I= 11 


4- 


■1 41 Tl 


tl » 


tl FT « l| 


*? 


*l 


[» #1 25 


■ ll 


PT II »2 »l 


4« 


-F" 


f«. bi rC 


•9 II 


4) 4fl if* M| 


.-: 


J, 


ft 4131 ll 


B *| 


74 ■ 25*1 


'1 


u 


4* 


34 •■ 


" « (t tl 


11 


■>■ 


1 . .-■ n 


31 11 


;<l ,'jr 


ll II II !4 II ■ I; 


14 ^1 17 VI 


« 


IF 


1' *f»i 


.- I 


35 11 ff 11 


If «■ 


ll ■* ff P' 


□ntci- 3Jtla 








:ih-i :*:c 










M HI UV ill 


,1 


» 


11 n » ti 


•Tl H «] FE M 


H 


p> 11 im 


•t a 


ii a* 41 n 


.1 


13 


ll Ff ll 


*. 1* 


41 J Ii f. 


■1 


■ 1 


111 rrl V. 


« l-i 


41 BUR 


11 


=- 


41 tl 34 


41 n 


1L It 34 44 


1 


■ 1 


ii tl 34 


■■I 1 1 


'- m ?-.■ tj 


It 


41 


'« 41 V) 


* 71 


,1 .-I ,111 


I't 


tt 11 tl 71 


■ 35 


il FI 4* 4n 


,■ 


4| 


t- m n 


Ji 1 


*4 M 41 pi 


•n 


... 


K. Ml 11 


n » 


>1 41 if) ■) 


-■ 


P- 


r» ti ri 


r k 


ti It 3m i| 


11 


». 


14 it fi 


ti n 


« C )1 tl 


7 


P, 


^J is •! 


(4 If 


» J I- ill 11 


1 


»: 


:i ti fi 


1* If 


me is 11 


* 


'■■ 


.a tt 'i 


l^ H 


*1 r. It 11 


1 


pi 


'4 Ft UK 31 


tt r: » v 


r 


w 


14 tl n ft F| 


n it ii ti 


i- 


'. 


It tl 'I 


If II 


1; ■ m ti 


ii 11 


ll J* 17 


n ti 


tl 4- H tip 


<* 




.'I 44 71 


tl Ft 


IT It 19 tl 


it u\ 


11 h ni 1 


it t> m ti 


n *■ 


.1 H 7* 


ti » 


Ii ii Ii ji 


T 


■I 


♦*[>•; 


m 14 


*'. f 4| H( 


c- 


* 


•1 tl H 


■ 35 


nnin 


4: 


t: 


.1 11 » 1 •'< 


rp 1: Ii ti 


1- 


* 


,"?■ 41 1 1 


tj 17 


■ 1 m m 4i 


n •; 


FI 41 tl *l 


M :: 'f 










tUM- 1^(11 








V*Tl-7|p» 










Ff t! 117 71 


1: 


:v 


« rr « 


11 74 


II V 41 If 


1/ 44 


11 11 it n 71 


ni ji is n 


II 


ji 


4) ll S* 


41 71 


11 :i 11 >i 


15 


j- 


•J tl 34 


41 Til 


■a >1 *i rt 


It- 4; 


t? HI » 


»l 71 


j» ... ^1 1 ' 


71 


.'■1 


11 tl It 


11 14 


Ml 7! 41 » 


■■■ 


H 


>} *■ H * 7* 


■I 91 II fc 


-' . 


■ 


11 n ii 


w tt 


■1 f: i: k 


.' 


.n 


7" "1 f> 


"1 ' E 


3} »; 43 t; 


'.- 


;■! 


JS 41 Ff 


31 4f 


m ft HI: 


.'• 


hi 


tl 33 rr 


■ 1 41 


3* 4t n t. 


rl 


:•■ 


1 M pi 


J\ ill 


11 *i nil 


■ 1 


.1. 


r*II IL 


Jl HI 


»« nt: 


-. 


K 


II 41 35 


■1 13 


•1 **'. OH) 


j: 


Ji 


J4 41 Ai 


,11 1 


• ' « j 1 1; 


>i 


.11 


,-■ 41 U 


■ 1 t>3 


** m i* t; 


in 


31 


FI 41 If 


41 PI 


1* w »u 


ri 


.11 


■- #3 t. 


31 tl 


IS « T| »J 


l» 41 


*i j* r: 


77 VI 


'( imn 


1! 


74 


41 25 11 


r: il 


4' 41 11 jl 


t: 


»tini: 


t: « 


tl 71 tl 7» II 


n 


I* Fi 


■ 71 


ti nun 


k 


■*■ 


15 tl 34 


m n 


•1 r ii it *: ti 


:4 4i rr 


■ FI 



n 1 1 1 1 ti 3a 1 1 . 1 *i ,i t ; ;: 

n 37 11 n ft 1 « ti a t; n 

1. n it fi k 3 43 *i n tt n 

W .rr tg |j n , , .,4 pj| j, , t j[ 

*3 i« »3 ti 74 »t 25 ti f: n u 

tt pi 74 pi t ii nn 11 11 «i 

71 tt -71 t; f| 4fJ .J. PI r. J4 P| 

f) tl Ft ti It H, 1V1 J* 31 'F 
C-FC4- |74» 



- 

fi m 

>. z; 

tt 71 

7 3*4 

Pi 4. 

4 74 

I 71 

»• 47 

Ff 77 

a io 

Bl 41 

«. ;. 

•: 35 

I? 75 

r r .- :. 

17 n 

l! 34 

19 15 

PI ii. 

II 35 

"HO 



*7 1*4; 
ti r( ti 
tl Ft 14 
11 tut: 

tl .4 II 

fi r>*; 
vHh 

ll Ml! 

If 11 II 
» r: 4i 
II 71 II 

II I* 41 
II T 13 
11 1 l« 

11 1 m 

II *E ti 

11 n 11 

1 1 .4 ti 

It If 41 

ii fs t: 

' 1^41 



,<4iil n 

m »i *i :• 

14 ti #1 ft- 

; 1 41 7J 1 

15 41 Ft It 

Ft 4**7 i 

;i *t 7i i 

.1 (1 il I 

■ 41 1'. II 
5* 41 JS I 

a •» 11 it 

II !DI| " 

11 nil 71 

...■,.. n 

13 17 11 11 

14 17 l| J| 

31 It 11 I 

■ trt "i i' 

n ■.' j.- 91 

tl 41 4|*-.'i 



13 3* 

t: 71 
tl 71 

F| It 

.■' n 

TI ft 

71 It 
'f HI 
I) H. 
tl H 

tl 71 

4< 1 1 
tl 11 
tl Jl 
tl 17 
il IM 
tl 14 

,r I 



TlWt-iSH 

FI 43 »I 1 1 1 1 

II 77 II II 1/ 

«. ifl 11 ft tl 

Si 33 I] FC tP 

• I 23 ll M tt 

wi 7^ I] FI tl 

41 Ft 13 IF. 1* 

4t 3>l * Jill 

41 'A I] FI tt 
IIFINtlll 
41 41 |» ll JM 

<r. ti -t ii 15 

f 11 S ll F( 
M *| H H ;l 

}.' tt II IF tl 

1* tl » ll 31 

« il 74 11 n 
w tt » II It 

*7 II "t II 14 

41 31 .' *t *t 

11 ri ji > .1 
LpIIXp 5 lit 

llrHl-114* 

PC 44 JF pp pi 

II IJ 11 Ft 14 

« 14 41 351 11 

11 73 11 H pn 

«l It M 47 KJ 

*■ 44 Pi II 11 

43 |j JJ ll n 

■7 FFlU 
tl 14 H I! 11 

44 «: ;t *t t) 

Kuan 13 

14 4] -,1 17 13 

74 t| ;r> | L FI 

Jl 4i It It FI 

15 IE If tt «J 
1 1 it in hii 
4* n ii h,i 

II H ll 35 11 

■ 1 74 (I 34 PI 

41 11 II lit. 

Ul 3= ll <l 77 

b; c l: *> «i 
34. tl 11 11 » 
M jp: 17 11 711 

B? 1| It il 11 

t"l FI IT tr 4ft 

tC 31 14 1: Ji 

K ji t f :■ 

71 « 11 11 II 

71 44 *1 II 13 

75 II :i 1: H 

miiiitn 

= E »P -ji PA ll 

1 .' H ii ; 1 .1 1 

II 14 H FF 11 

" ►:<■-- 1S43- 



B 41 ri 
44 «C ll 
M II 41 
IP If ll 
lit :" « 

* Hi: 

4l 1-d *. 

It'Hn 

•EMU 

« mi 
■ nti 

41 II 14 

■» II *s 

4» 4 i jp 
m i< m 

* 7111 

* PI 71 
H I5.4TJ 
•9 tl 74 
.1 a 1 . 



r.i 4 j 13 

31 II M 

31 It -i 

H tt 11 

(ill ti 

3' It >3 

3» tl 75 

I! It Jl 

3- It »5 

J4 *t IE 

F| « IF 

It 44 11 

I Ji f 

■I 11 15 

•I Tl FI 
F| 71 X 
I- «> 11 
■I ll ll 

II 15 11 
PI It 41 



Ft PI FE 

II IT PI 
4! 44*1 

!■ 4n pi 

11 M ll 

41 13 PI 

II 7-i PI 

•I 1* 11 

41 13 ll 

m IE, 11 

11 n f-j 

11 rr m 

: 1 w rj 

. 1 *• " 

HI PI II 

U II 35 

15 tl F| 

FI 31 43 

71 tl 'E 

FI II 12 

Finn 

I 14 tl 
31 41 
71 II 
71 II 
74 11 
« 4| 
FI 1Z 

II ll H 
71 tl 79 

15 

« »1 ri 

:i ti .-1 

7M PI :r 

31 JO * 



• I . 1 ■ 

31 11 il 

m 11 :i 

71 II ij 

7- 11 FI 

II II 11 

7: II 73 

t: II FF 

II F3 K 

■C 17 ll 

(C 13 II 

Hill 

it a n 

Ft 24 11 



.-■* 



It FE 1ft 

II MM 
n ll 3ft 
33 44 A 

PA PL ■* 
7*11. 35 

BH K 
7i 1 : m 
FT ID IE 
71 43 J.) 
33111 IT 
1 1 IE I! 
13 17 11 

.-. :f 1 1 

41 11 F| 

*: 24 ;i 

U 15 : 1 

I I .1. 

pi II II 



■ 1 "- r := 

; 1" jj 
31 77 tl 
4= 73 11 
01 F: JJ 
it FIB tl 
,1 1 .■ ai 
.!-, . . 3r 
41 IL 19 
--•, :e l'. 

■h I! 3FJ 

PFj 4; 7J 

it 3 .!- 

PI 71 ■ 

11 -'. 3* 

* .: a 

ii 11 ,' 

74 ai 35 

31 tm 23 

rjfiriFt 4j 



Ft tl 

Jl 



' I 
FE 37 
F ' P3 

■ I Jl 
PI i\ 

1 1 Ji 
1*07 
.■I Ji- 
ll 1| 
11 71 
il 35 
FE 34 
11 *: 
p: II 
Pi 35 
4: '1 
tl •; 



ii pn 

ii n 
1 31 

* .1 

40 3EI 

I 35 
4 74 
r. 35 
4f » 

II 7JJ 
IT 71 
IP A 
II .'« 
»l 75 
II Ft 
II 19 
■ I II 



11 I* 

'I 14 

11 Ji 

>] 11 

'1 IE 

f: 2t 

,. .. 

II ■! 

>: ■! 

11 ■[ 

11 si- 
ll H 
4| T5> 

tl 't 

■* ■• 

15 4i 
• 1 p; 



tl ir 
II 11 

11 .: 
.11 1 

71 C) 
14 (I 

' I ..I 

ftl Ft 

.1 1 , 
ft* 70 

I 
■ 1 31 
II J> 

II F|. 

31 11 
II If 
31 ■ 

:» j 



I I TT! 
43 ?7 

'*!■ =7 

13 an 
Fl 27 

0: 'L 

I- K. 

ri r- 

II rr 

P2 ? = 

.IF ,"| 

31J 71 
43 24 
HI J* 
ftl 73 
41 fl 
ll 4. 
■ I H| 
74 || 
,1 Ii 
73 ll 

Til: 

Ft 34 



r. n 

r, it 



74 7- 

tl 35 

*l| f5 

«l f| 

<" If 

»' 7 

If IE 

31 It 
flU 

■ I 3* 

1 II 

■I 3t 

PI II 



11 K 

11 *: 

FU M 

73 ti 
;■■ n 
11 li 

• ' f: 
i> 11 
I: ll 
H 11 

11 17 

Zt -'I 

11 71 

II ■[ 

a it 

11 pi 

r|4 1 1 
31 41 

• 1 tt 
ll P» 
1: « 

• F H 

«; 11 

PI M 



*■■ 1% 4J 

m 11 n 

Tin; O 

21 tl 14 

p; i; :- 

.4 11 ii 

r- tl ■■ 

J3 II 71 

34 19 ,71 

75 II Ft 

73 11 l| 

il II Jl 

"I '1 « 

J. ., .■ 

tl ll 74 
71 11 3*7 
T> 1 1 ll 
Fl il It 

IF l: it 
11 11 41 
ti 11 41 

MUtl 
fi .4 tt 
ti 11 tl 



»: 3 

41 71 
II Ft 
■ I S 

pi .. 
ll J! 
il f 

I j jj 

»: 1 
It 41 
17 il 

II 11 
■f II 
it il 

41 7' 

• I f: 

It Fl 
It 41 
74 Ii 
il It 
14 >i 
14 Wi 

H «t 
'I ri 



II |: Ii 71 11 n * il it 1 m 

11 31 II ,'l 1171 E l-jll ) 47 

[ f II 13 II II 34 B» 35 11 -[ ;.- 

13 tt II 94 (I 11 41 H MI 3* ftl 

41 21 ii ri ti tl 11. ii 21 ti rt 

llll ll ttllB -: 4 1 ;p pt il 

7fi 21 FP It 3« 7* Tr 11 FF 
iPfll- 13441 



ltl>l|-'JJ-t 

z u: p> 1. 

11 r, ii ie 

It ?* 43 15 

it P. *: . 1 

Ji t' Tl .1 

fl ^ 41 II. 

i| ■! 12 13 

11 V. II li 

It n ii m 

1 1 77 II Ff 

15 fi II K 

Ft 71 11 75 

IT 17 41 74 

11 11 41 25 

11 U 51 FT 

n 34 43 J] 

41 24 41 || 

IE H 11 C7 

|1 UJ *| H 

■1 11 it rjs 

PI 71 17 33 

-■3 Pi I L 77 

77 tl FE Ii 

I. II IF- .-5-4; 



PL El PI FT 11 Ii £|, 



■ I 31 

IF 73 

11 rt 

13 

■I 41 
13 j?J 
II FE 

ijttc 
tan 
4: r: 
11 :: 

41 ft 

40 II 
17 71 

m .-1 
1 1 fi 
11 75 

41 ft 
41 71 

11 tl 

11 ti 



II PI] 31 

*3 (: 

ftl FE 11 

utttt 

I 41 Ij 7* 

B tl 7E 

1 ll IL 14 

H(f» 

I t: 34 

II Jl 

71 II 

F| ti 

i 17 



Ft 19 
35 ll 
75 II 

FF J* 
11 H 
™ Fl 

34 Fi 

2rl PA 



11 Ji 
F| 13 
H W7 

11 24 
tl 15 
41 V- 
t> 11 
tl 24 

PI . 

• I 71 
Ft 13 
44 17 

■4 14 
p. I, 

12 41 
■ 41 

n 7 j 
11 17 

•1 FP 

11 tr 
31 42 
II 



it n 

Ft 27 

F." J> 

15 It 

11 31 

7^ ,'l 

FE tl 

ftl il 

HI 73 

73 tl 

If JJ 

Hl H- 

II ** 

II 71 

11 71 

• l 71 

IF 11 

■ tt 

II . ■ 

13 75 

M fl 

It 44 

13 21 

ll JT 

Ij IF 

IIIL-L" 



Kn 

47 7J Ii 25 ll 

41 FI II Ft Fl 

PI I tt K tl 

31 43 35 t| 1 1 

23 41 Ff II Ul 

FF. IP I? Ri II 

It • I; 34 II 

■f Tfl *! .1 17 

41 ■ 1; 11 r 
91 33 •: ji m 

'E 23 tC K- It 

44 A 11 74 II 
411 J4 Pi J7J. II 
tl 23 11 Ft IF 
tt 30 tt Fl IF 
17 35 ft| F( K 
IT 3* II. 73 II 
M 44 n M 11 
3* 41 75 41 

n 11 it « 

r- 7i :i r 
m *i 11 .1 
» ii n 41 
r, 11 Ft ir 

FE *: 13 tt 

II 41141 IF 
IPJ-I 



• I- ..I ,F. 

1 1 12 tl 31 
II 1| tl II 

11 11 n it 

if ni 34 H-L 

ii 11 ii 1 : 

35 II Fl Hf 

;;"!i if it> 
11 II ft tl 

14 II K It 

ntinii 

» Il Ft » 

imiri 

11 13 II 11 
■• 4) ti 77 

nut: B 

71 IP 7-1 4", 

15 II ff 45 
F| <l H tft 

17 44 tl M 

I) JTfl 11' 

71 «■ ■• pr 

It IC 13 -1 

14 tS II 74 

It .'4 41 rt 



!:*WT,3F74 
Fl P5 13 ll 

II 37 l| 1 
IP Jl I. II 

ui in Ii 71 
ll 34 It 31 

h; it 11 ii 

Fi 7| IIP M 

ll It 13 3i 

FE IS I* 11 

II PJ HI Ti 

•I 74 11 3} 

IS li II 

tt 74 tt 

U (T, II 

t: » 11 
tt i-: ii 
i" 11 pi 
II 3i 11 
11 tl 11 
.1 11 11 1 
A tl 't 43 
■i .-: il fi 
ll 41 41 74 
H4f4' flFl 



ft] 11 ll Ft 

Ii U 11 It 

41 j-i It ri 

w 75 it n 

pi 11 it 1- 

11 rr 11 » 

Hi Ft It It 

II » 11 7| 

ll 31 It 1- 

p: .- in .1 

•1 rr 1* k 

17 K 11 ll 

II li 15 15 

• l 1*j ll If 

■1 FI |C tl 

... .1 j ■ 

II tl » tl 

fit 71 II 31 

131 tl Ff I* 

'I K Ii II 

ID I) ll Ji 

Cl. 7* •■ is 
ff ■ I 



f3 P4 
Jt r* 
F» .'. 

a 71 

Ui tp 

Fl n 
74 19 

» Ir, 
>\ ft 

^ , 

m ii 

« It 

t - rt 
it) UJ 
» it* 
11 .. 

II 17 

m « t 

4 *l 
«7 IS 

it ta 
e M 
m 11 

•4 ip 

*. r.i 

41 IA 
4F f.| 

4* FF 
IF *4 
It FA 
)' 4* 
11 ll 
■i ,1 

I! ill 
4| *4 

11 411 

11 :c 

41 F» 
il II 

tl *7 
II *t 

-.1 Pi 

■ h 4| 
0! ni 

ft It 

Ll 19 

it! r^ 

tl 34 



ptptft 

ri -1 -■! i- 

11 pt 11 ta 

. ■ ■ -■ 

►- •,: A3 ll 

t 41 I) II 

l> il 114 I 

14 Al 13 11 
IF Pi i» 5 
ll tl » I* 
H IJ Ar. 1-. 

1; M 47 :t 

41 44 Bi 1* 

il n> 1H hi 

SI *, If II 

H3 IV- 11 11 

t| ! Ill l| 

■ 1 +1 !F1 14 

•:* t» a *5 

..J 1' J* »! 

M if en ii 

41 1- *• ll 

41 PU *9 *» 

IF>P)H« 
tft I! -O PT 

it -» n rt 

4A. 4* IP Ml 

BlIPH 
(I U II If 
4* It 174 Fl 
FU Fl Fl ftl 

I* i-i. J' 14 
F* pi ft* F* 
■■ 41 ill 1. 
»» II M !' 

15 11 A7 |l 
•1 ti il In 

n 71 b5 it 

- - I .. I ■ I ir 

ft' M It tl 

iii tv it ri 

11 £ : Ii 1. 
fW 41 It I 

JA F.- IP «* 

re ie ct a* 
H r ifm 
M it 19 

i: ir IE 

*i EI E 
17 43 

11 n 



ii- 



tJ 



I. ,.,. 

'It*! 

14 11 

I". FP 

H? PU 

It II 

IB p' 

It » 

4.' 41 

ll- F.I 

ID 44 
It -.I 

• P 31 

47 71 
t| 11 
IP l" 

a 1 m 
1* 33 

II *H 

43 o: 
4* ii 
aiK-t 

SI FU 

£* 47 
or 44 
in +■. 
MM 
it (4 

II |4 

IV. IV- 
Irt tp 
En » 

47*1 
Ei| *9 
*4 44 
ill - ■ 
*Lj 41 
4AM 

FC JJ 

.■: :.i 

41 Ai 
fl m 

*P Al 
ftl AA 
ni 43 

.'!■ IFl 

SI fd 
4' P= 

f: a* 

"1 M 



li tl It 

73 tl 14 
Hi J-i 

:• *s i) 

•I 44 11 
11 t I 77 

10 11 13 
17 JJ 11 

11 Fl trt 
13 K IJ 

13 I] 74 
11 tl 11 
*l F( tC 

7 14 IT 

•J t: 14 

■« r; .1 

tl ft* 1* 

i;n«: 
1 pi it 
*t H i; 

IS 75 li 

p. rf *. 



4-1 WL -f. 

ir 4.- a.. 

rl A3 12 

17 t] 41 

1=1 43 1 -1 

'3 44 HI 
'li" U 

34 111 1-1 

iii - J-. 

fa a: ee. 

in 11 47 

.-Ei t-l M 

43 13 43 

fl C4 Et 

li 4 . >'l 

m *i 1? 
+1 ri ip 
41 13 '1 

. V . - I 

pi mil 

P3 4t li 

*i fft w 

47 :* ii 

IV PT IP. 
It tP 1* 
IF ** 54 

m it 15 

B Ft II 
•ft 4- Fl 
31 Jl IP 
JA t* 71 

¥ rut 4*1 
as 4* it 

47 13 IB 

ll llln 
It Fl It 

!PW|j 

It II l-.l 

ftl 15 40 

m v it 

41 fi] 17 

LIT FU F| 

11 C J IA 

17a AB BEf 

II I ii Mil 

4J *-. il 

M iA 31 

BB Bl 4A 

11 *1 CI 

IS 4-1 J|-J 



'1 ii Hiii e *t i- 

tl u ai tl 44 AE 14 

11 -I H I) I ll « 

A3 IF II Ft 1 |l ;J 

.11 pi id ti ia tl j.3 

pj -t il *i IB 4- 31 

45 ■* Ct It 43 PTt 34 

nl U II « IJ Al I) 

"i 'A Ia *i m n 19 

4' E| It » «3 I4F* 

EM Fl ;.n Bl tl (4 At 

40 CI 49 41 IE 40 FQ 
It 11 Hit 11 4C •& 
HilHrHtPIIE 
191 PEL ftl At CI It Id 
31 ll H It Fl B* 14 
tt 41 M IF CI 1* 44 
Fl 11 * 15 i; 44 It 
If rt P* tft It «F » 
WHHHNltn 
H* nut 41 " 
•4 11 FF 41 " m PJ 

ic ti h n u h 11 

•4 S 43 AT fl ft II 

II * F| 4 II 11 B 

*) fc * « ff I) 4 

M 01 ll «4 I) 74 11 

41 ftl 411 UJ Ff 41 IS 
It A3 4011 11 4) If} 
I) t t J.tnl H 
411 m 54 A3 tH 34 11 
•4 Ql 41 H 1 f IO H 
KIHCIllMH 
» JH P7I II Ft P4 II 
I* 11 H 44 B4 AS |1 
4C l{ |1 «| 4| Rf] I 
It jl ifIii it 13 
13 It 43 1| IE II 11 

it fi Fi mil tt 11 

B* rt A3 I* |i AC ij 

13 49 |S 41 tl 4m 14 
Afl Fi t» I- *I AD TF 
l| C3 40 FI 34 Ll PJ 
'a Pi It It m « iL- 

11 |4 M It 1 I At ■-! 

t rA tj; cl'.iji: ;> 

34 « It II tl 42 II 
I'CI ICIII-RI W 

14 II ll tip FP II I'r 
•» I J II PC 31 C3 ;» 
■>* 15 15 11 ra tt rl 
it J* ia n .« m it 
•' it 4 r. t: ia it 
4 It « » « « 11 

PS 71 It 71 It- PJ 7.1 

mi mi nun 

H n h 94 » a h 

D4 fl (ft f 4 tl ca tft 

nt ti ta 11 iinn 

A3. 4j ff tl •» 41 M 

11 II 44 II I 44 71 

it ii 41 31 r 11 h 

•Jl ■ |tiPim.| 

II II 41 45 1: A3 ■ 1 

t* 11 MS] f TC '3 

El 31 ■:* ID 5P U Pt 

if ji it » i". ir m 

il\ .ji t| i-n *p jt P* 

ni +: II E3 in *t j 
ti 11 mi tj in 11 
41 □! i r ai m nt Ll 

It ftl 11 7F 13 44 II 

ic ti 4« jp m ni ji 

21 A" ft* 14 II 44 Bl 

Hj HI 11 i; ]| A7 14 

44 ai 

■■Lf- 1-3171 



"■r«T'M« 

lil'BIci; 

3E CI FF EH tl 

m in ct 11 34 

1: El «if, ..; 
II 51 11 A3 31 
AI Bl 45 3D M 

H CI II X IS 

CI H H Et ri 

-■» mriw 11 
*5 Ol 45 *i II 
IL SIE 44. 54 « 

II HI H « FJ 

11 [I 9* IE if 

r 1 ft' Eft EF *! 

44 III 44 :3 Pi 

It CI K »l ll 

"* H 7P 77 Hi 

IP Ll 11 k I 

til rt 11 tt iv 
15 H 13 91 BrF 

. I- PI. II 31 f. 

can 1 w 

V H H 11 71 
Bt II H ll If 
I) 21 2! II £41 

-< -- -i-i 1- 4 
: l II ll ll li 
35 4 13 43 It 
1=1 II II It p 
14 31 A3 t| 11 
If II A3 13 SI 
pfe 14 14 pf J I 
** B 43 V 43 
.1 tl ' El it M 
it 11 in 11 it 
11 « n il it 

»om)nt 
A4 m 14 71 44 

nmiitp 

ct M It 1) 14 

p »i 1 

ID IIHUH 

»: " « ii 1. 



33 13 
» 13 



V (I 

FA >P 
■ft »5 
5C it 
45 F7 

■n Fa 

« Fl 

4a (5 

• p f 

44 49 
CI 14 

=A_ ■ P. 
41* tt 
14 tt. 

:c :t 

41 "i 

PI '3 

PI IP 
13 ■■ 

A* 1 
II ip 

13 cJ 

■F 17J 
IF 11 

« 19 

Al J-t 
II tl 

0* (O 

** II 

Fl It 
FI K 



f DM III 

pi p Kim 
n ji'i r* (7 

14 A tt 11 H 

t! 4 II p I 

4f »[ »* Fl FP 

44 m ij ic it 

K. 41 IF 411 If 

H7 HI IT IE 11 

11 • p ■ 55 : - 1 • 

17 11 M H AF 
« IP 0* II 51 

-•■. ■ ■ —• .. 
It ll 4|i 14. ftl 
* » It It 11 

14 pi ir 11 it 

34 fl Ia ii a- 

Ht- 411 14 17- ftl 



It !■' 

M || 

*e> ;l 

ir. «-,- 

(& rl 

IF 1| 

*A I- 

tr> P4 

» (I 

I- 10 
Ft 74 
W 4ft 
If 40 

14 II 
14 fl 

H tl 

13 pt 
fl H 

•3 IFl 

Al -■■ 

14 11 
n r-i 



e; mp h u 
*■ m At tl 

i .-i 1 - i- 
CI 51 r» it 

AS If lit «■ 

I 14 II ti 

I 4F 11 51 

■ I ID 13 || 
IF K >■ 13 
94 17} 3| 71 

Ii n * i] 

3' 41 J- Al 
It IP 41 W 

•:: ii nt m 

H it u I| 

at at is ir 

H AS !| z* 

M 11 IS ^ 

Fl" III I* 3ft 

H ft? rs tft 
tl I* II 4) 

IF AT ll It 
44 55 IB FC 
■4 fl U Fl 

-"Mill 

H II €1 43 
K CI JO FE 

IEH4 11 
Al 14 CI 44 
* 31 JJ) || 
41 CI 43 94 
31 f 1 TPJ C9 

II Al * Aft 
Af A| np P7j 
41 49 PA 1 I. 
14 13 41 Cn 

43 43 PJ IE 

m 44 il m 

■4 It E> *4 
tt AC 47 44 

MM JH 54 
h II 4 II 

ID E3 13 13 

1L IIP AP 

3! 4C (■ Al 
■7i 4Q -ai IR 

■■ fi m 24 

B» Tl tl tft 

■ 1 "HI « 
3* 11 13 il 
M A* 3t M 

44 A5 43 45 
14 13 *3 43 
ii 4 p c 
A3. 13 F» 17 
tt, IT- » ft* 
n»m ji 

tn At pj Aft 

n>tt)i| 

44 24 E3 4* 

TF 74 IJ 15 
44 14 Al I* 

H II 77 4 

El 4* 13 47 

34 44 41 PC 
4" F3 41 It 

ii 1 r 41 ir 
ti it p 11 
01 A3 43 II 
44 Hi 19 LEI 
» 5* IJ IC 

at 45 43 a* 

Ll H I II 
n IC V EH 

» B4 r 1 *c 



:o ti p- in 

Hill x 

ca 11 Ft 1 a 

14 17 « tl 
miC 111 jt 

oil ii M 

II K II CI 
Pi T) II II 

1: 1! 4 tl 
li 44 M ta 

ipiiiip 

13 ftl 39 Aft 
II 41 41 41 

if. p* *J nft 
I! -E F| 3j| 
JI tl At K 

MH4II* 
nniEI!l 
-'. H II tl 
Dl II tl 74 

LB HB rn oft 

41 II At H 

II It A *I 
nFDH H 
44 4A 41 ft 

«i:ciii 

4*. i; -. ..■ 

IA Al U If 

41 NI n U 

44 » 11 Fl 

41 FB It II 

p|i IIP 

44 ll 4 It 

ftl At El AA 

Fl 4 1 AJ IJ 

tl 44 41 11 
31 IJ *p ^ 
■P pt 11 K> 
Kftll 
IA It A* ll 

14 KJ ll It 
It wi 71 art 
A» 37 It 11 
4* -* 1 P J* 

11 11 n m 

l*|A fl Eft 

it 11 u ji 

Sftt] ai «« 

I* ftl 11 rt 

Fl 7| 41 3 4 

It .1 'in 

I* ir a.- 111 
»4> El to 

It I *l I ' 

i74 ri ji 1 i 

IA H3 11 PJJ 

H 1 1 Cl tl 
IF II 11 til 

Ull ttft It TA 
n S II 14 Ml 
it it in P 



00 VOURCCJM^UTEaM^CHiSSS 



r» Ca 

k H 

i* ati 

« f4 

i- 14 

up id 
i- M 

■ H 
4 *■ 

i. , 

« H 

■ »• 
« «l 
*J « 
««' 

p/IPpTIpI 
* M I 

31 PP l 

it EE 

it H 

H pn 
:■ m 

rp ai 

■ i ai 
M rd 
w *c 
» «s 

il jr 
XI 13 
II it 

ji »r 

H Kl 
M 43 



Wl- On 

•uttti n 

M II H li 

r ■ r. >: - 
Hpi 9i Pp if 
rJ.fi-." 
if • » 3* 

n i mi 

I) > <lt I) 
iw it 1* * 

*t » ¥1 * 

MH4CII 
1 Witt 



P5 aa 
e« is 

M E"j 
-,-. i 
#7 »> 
f i Zl 

t!H 

43 J* 

F' /■ 

*1*3 

«t -: 

CM ■ 



F) IC P> 
« PP 61 
EL « H 
i.- .j : ■ 
DI1M 
F7VK 
t> If *S 
r* *t ap 
•:■ £a *r 
fj * >I 
■ i n «g 
ii tr ii 



■ 3 -I. IL l 



«■ (VI 

i,' ?* 

II P3 
li *# 

n a; 

I] 21 

pr r» 

.£ » 



W tM 
iiM rw 
M 7* 

*e *0 
■ : en 
*> rt 
i* *« 
tt n 

n it 
■i *t 
*t M 
S1 .* 
H CI 
•H 44 
Fir- a: 



FT) IP 

M 3p 

AI nl 

-- ** 

i " t 

.1 P. 

it ai 

ti ii 
i. ai 

f* II 

*f> II 

II II 

III PI 

W «" 

fpp fl 

A3 £ 

71 "Ji 
mm pp 
J* pa- 
pa 71 
M Jl 
■ I M 

!*■ ' 
It « 

n3 3F 
-t «l 
47 n 

K <• 

111 F7 

Pif PP 

U 4 

ti * 
u aj 
» n 
4* *• 
at ra 
11 ■> 
*> ,-t 

H fl 

3a •-. 

■ '.■ 

14 It 

rt If 

Fn p- 

« [4 

fl u 

IP M 



44 i? «: p* 
it k h ii 
HI H B" 31 
if 39 M PI 
If »1 AC «J 

m 14 "■ >E 

|l *C K « 

ivm *: ■(■: 
i !• ■ i -i - 
HI;** 
II fH (3 
»« i»j i. •» 

,-i ..- .r n 

»< :* i; *» 
*:• . f t- 1-. 

FJHif n 

nnciu 

.■< <P /I -T» 
l)'!»H 
»"t 1 

•3 ■*» *J J* 
•P i»P i*1 M 

«S fa Sr *• 
« [* II rr 

Hfl l"1 ril m*v 

it to bi re 

,.l *W ,'■ *>v 

CI « H F» 

MW'* !i- 

p( p. r, «■ 
:> F5 M C4 

JF^ hr. I -i 

•< ni r= » 
13 t; HI K 
■■ ii «. u 
« CI II H 
(Ff ff P| Pf 

•• ja in 4i 

KJ « Fl HE 

pa pi ii ia 

ii 1 IS ft 

t? ** -.• I! 

>P =r c. "a 
i; it ;j h 
»; «• u ft 

» ■( H » 

i)>: kt «e 

rt "1 -t 3ii 

LiU iH - >, i 



T* tin 
m t: ii 
•* r* *( 

'i •• ii 

■ 7 "7- Li" 1 
l> -" » 

nan 

i ** if 

Hn U 

u i in 

I IH II 

PI PJ II 

• »■ ■>• 

■ H4I 
itt**i 
i» "i" 
pi «»*• 

HJlM 
PI PT*f 

P| Jflf 

M •*.« 

13 3* *l 

II M r , 

,1.1,-1 
ii C*r* 

M 3D M 

is e* u 

11 If ID 

*L L'l « 

UFIM 

W IIP PI 

r 5 »a Cl 

12 H T* 

i P> *t 
B«f] 
H> fl f* 

M *f H 

■» m m 

^4 n pa 

!* »,- ifp 

ii a: it 

n k n 

■<■> -'. (■-! 

Ft 35 31 

IP II 11 
B3 « ^/ 



« *r «t w 

fh «i M!i m 
intmh 
r » «i •; 

« *f up pi 
IP PHif W 
ff « ip (I 

-K *3 HI 

1 j rt «•■■ II 
[p ii -.; .: 

■J :i H :r 
r-i PU If I ff 
CflilH 
:* ai ;..' e* 

IP B) 15 si 

is »: nt Ii 

[1 U Fl «! 

m '«!.< 

pr vi a"i »-.i 
i* fj 9/ n 

\7 IE' IE p> 

•o pa n tn 

M »i 1 1 >5 

» HH H 

:f *0 I L I 
H tn m n 

13 E* E- M 
I-- i: p.* ft 
pz ip pi r 
HK«II 
IPIi II 
EUHI) 
• HPIC 
rSHUH 

Hnm: 
»»»«) 

DHH* 

*• «j !c r 

i* it as at 
13 •• m c 



"■:•:■.■.?»' 
llniua 
<l -:i £1 EB 
jv Mil ah m 
IE IE A3 B 

■3 m- rt fi 

*rt "L i* pr 

k [- ii n 

Nrnri » 

U FH '. tt 

MHnn 
•» « i p * 
Hj Jpjpa la 

r> »t? p- 

O •! A/ If 
M «t ?t 'S 
H P> m P 
«i|»lt 
H H !» (1 
•; l*. <q F| 

It II < I It 
*» il it n 

.-, IV .1- KJ 

If Fl |l .;■ 
•4 F! m 13 



It II 

Fi p-p 

Hi H 
P* i* 

M I > 

la n 
At ti 

N if 
3* M 

... , 

'» K 

H *♦ 
•I » 
t* :• 

K :* 
pp M 

Pi II 

rs h 

Fl » 

5* n 

LEI (U 
1° IP 
« H 
A« Jl 
tP ftJ 
PI ff 
nl tt 
» If 

n it 

•A *C 

cats 

pa ie 

^3 i: 

7f PP 
2* 31 

It ia 

»' I.. 
7P FA 
Et El 

HI I II 

rd ta 

.* F4 

ft EC 
PA Sm 

,-P KP 
«D « 
•» pPp 
AD JJ 
** -^ 
itPP 
tt -I,' 
1J V 

Jt at 

H Fl 
Id Ii 
ppT IC 
AI 3f 

vm 3d 
3C 3f 
•l PS 

PI 7fh 



13 ei rr ie 



" r 



■ f, 



M pp 
.1*f3 



M PP 

■ 'I 

Ji :s 

tm pi;. 

ft A) 



■PIP P»-P P TO 



MII3K 

-»>al ?* *■ 

W? IT pP nl 

pyi hi -rP pa 

M "f II M 

n* ti in l; 
w nr. Ill IE 

POM 14 14 
•9) H »« It 

nmim 

rt ti -x ii 

91 «■ Lt If 

■i r,i f ■■ 

■FilvFr 
E! II Pf PEI 

i: IC H« 

Fl IB -.1 HI 

K IC II IC 
PC IS li ta 
H H II II 
M » 13 tC 

« F* I? ?l 
* 1(p H M 

it m n pi 

f Lt t* ti 

« Af l?> » 

«i »; it •? 

41 *4 p? cr 
Fq tt K> ID 
CIKpIH 

m it a n 
p. m ^ pa 
t- W ~i :. 

n ii « H 
»: *: 'f » 
m m ff at 
t. Tt w m 
ai ib if 3- 
il a !f » 
II AK JP. nl. 

■ I IE li «S 
I? A! IF 3d 
m »l U |i 
=3 t! 3D £4 

ipjli pa 
iiiAtaA} 

*. WIS 7f 

ppplPIII 

una u 
<•] rait t* 

>.l «F W? KJ 

h ie it Jt 

HI HP 3f BP 

yi m I? »] 
n a n » 

n; IE IE PF 

r ac rr n 
i: l3F i. cc 

■ i i i .-i i t 

19 7| A3 K 

tl *3 *• J» 

U IP nP M 



p»M 
f*« 



At *9 



nip i ^ ip Fa tarn r i 

t* 0» tt » PI St tt 

F)Cl>AlF«I 
1 U » » li u « 
H 4M *J « It « • 

WIPPlAJl|(gH 
» L) » P M .' 14 

h tt ti ft ktia a 
ti;)(p»l)ttFi 



r« . ip, i ■ pi pi pip 



■i^pi 

r »: 

1J SF 
fl t3 
pi n 
*■ jf 
It « 

3" *' 

■ ■• . ,. 
II fl 



I - A3 

PI ti 

II U< 

l> It 

M fl 

mz 4r 

TF II 

f J if 

<: j: 

fl PT7 



BF Jp 
li t! 

t] tt 

■hi |l 
W 3t 

It 13 

P7 P. 

3C IF 

Pil i-P 

F3Fj ti 

■ I "If 

XI p. 

n k 

i |S 

iii «: 

P-' Jl 

>= «: 
ai at 
» *; 



UNti. 

if Ji 

- .1- 

ii if 

ii *: 

ir 31 

tv Pi 

21 L1K 

ir m 
» 71 

• i an 
•t il 

TT 97 

nii 
t?t? 
If -Jf 

I*B> 

p= ;■; 
i* 1/ 
12 li 
-Ml: 
./> is 

AIF ± I- > P" 

fi *: 
tf ril 
fp ;>-■ 
31 tf 

n tt 
=7 Lf 

^- i. 

t? fj 
«= ,F 

V IF 
« ft 

II li 
U M 
P* ** 

PI ,-., 

> If 

«■ It 

(* 14 

>»if 

J- -■ 
<■ p. 



J W 
It II 
•4 PI 

HE tf 
P> II 

J . 13 
.i i 
K 13 

pi n 

.■. i. 

• F IC 

... , 

H IB- 
W J 
P7 t 

■t J* 
a M 
Ht *7 

,-. i. 
13 ta 

■>-' n 

J» IF 

• J f i e: *: ii 



PJ- LP 
I* 11 
I" I? 
u fc pii" 
31 «! 
■ l Zl 

i? as 

F IE 



.-.J. 

T* IS 

i> IP 

n j - 

RS Lt 

31 !> 

13. 3F 
ti 14 
V BF 
13 Ptl 



3" 17 

n » 

■FF 1 [ 

I* » 

Pi Pi 

.' IIP 

* l> 

•f «n 

•7 Tt 

IT ft 

It It 

*> n 

3E 11 

*■ 3* 

ar ■<,- 

!• » 

ii rr 

* «9 

p .-n 

It » 

IF 19 



•a H 
v t; 

.' -•A 

31 K 

t? e; 
PI 
IP IE 

3c m 

« df 
T» 11 

II ,1 
pi pi 

»a 3" 
ia i; 
r- ml 
fi II 

IP JT 

I* *l 
ta as 
» ji 

<■- It 

VP Wm 

-I- H 

V 31 
P- J- 

,ii i| 

> 13 



pa M 
17 17 

7W IT 

3a It 

t7 17 

hi ri 
IP JF 

m n 

K IS 

71 7 

I? f 



It HI I 
JJ * . i. 
t/HW 
tttf It 
ti it ai 
ti at 3. 

n ii i 

k, p? j: 

n h • ■> 
...■ .1.- , 

JP V *? 

tm u 

Jl 47 Jf 
« II it 

Hilt) 
pj :** pa 
J»*: .» 

nil IB 
1* Sn it 

a» jc !' 

JhpfJ K 
ji « , in 

t}p)B 
tv k n 

1 7 B7 B7 
I'll) 
71 BP 31 
47 ml m? 
13 17 17 
II. II V 
49 13 K 
li M U 
ttlF I 

ft fl IF 

PP PP HLP 

II ?> .' 

1 If) Ift n 



at it at 

f: tt ti 
lit n :i 

HM 71 

aa. ■• k 

>p m if 

*»il 

■alts t) 

U 17 pr 
73 II 31 

•I li ft 
I* *? mt 

HE li 

n (i ii 

p>3 ij <E 
Hiri 



PFPi 

•7 X 

fiti 

■ . 

41 94 

B« 

i. j> 
| p ,(• 

BfS 

:•- pi 
p-i m 
tt 13 
fJ»7 
13 II 
A I If 
12 « 
5- H 



IHEH 

•t n «s 

a; *.- pp 
i ii i 

«P)H 

•; f»ai 

jp if »* 

KHK 
H II J 
man 

1- Jl Fl 
I- K ■ 
HUB 

» III II 
■r *' V 

i v I 



It PFH 

I ■ J PI 

i :i t 
•t <HfB 
at aa lf 



I I Tl ■! If IP 



ti 
aj 

■ 

ft 
l: 

■ 

41 

II I 

it i 
•j i 
ip ■ 
ti i 

#7 

.11 

I ■ 
P 

H 

1- 
IP- 

L' 

: 
p 

r 

■ 

pr 



II IZ 13 H H H I' II |I 



17 X •) 

IP PP F* 



ti n , 

« V : 
pr x i 
II K 
■a M 
If IF 
14 ii 

f £ I", 

ZA L7 

i; ■■« 

» 13 

p-i ;r 

3C IE 

49 IS 

- 1 .'I 

X IL 
In IF 



i ) ?; k 

IBB?- ri 

a « k 

f l u m 

DJ 1 

13 73 21 

il* J 

HIS ■ 

BF TA 

3f If 

13 13 C 

13 IT. T 

a ■ «i ie 

AFl PL-i pp. 



r. 

I, 



«l IE 

II J 1 

»hi: 

' *}*? V 

• a" tt JT 

Tf pa ia 

lint) 

BF W F 

n i a 

HM 
MI F 

JP ii.' -.' 

.- i ; ■ 

** i» it 
P. 37 PI3 

ff-a* it 

-.. ,1. 17 

j: » :i 

V H EE 
*v li 17 

i; ii il 

II IB FA 
17 17 P7 

IJ •* 

IV 

II *7 |7 
P. |7 17 

ta ii ii 

p. ,- pr 
13 II 43 

IF y a* 

i* a* tr 
« n « 

K » X 
IP II tl 

41 *I tl 

■riKpi 
.-i i- 1 n 

44 Ft I L 

•' 13 t> 

.1 f I i 

i: it it 

i. n ■ p ■ 

ii i*i i 

41 3) FJ 

Pi 47 17 
11 ti Ft 

ii m ii 



if pa 7» ft « 

« «.• ji » n- 

12 43 41 13. H 
34) 1 H 11 ,1 V 

it ir ji j. i.. 

IP » '1 II Fl 
Hi 1 .in 

m ■ ii y ■ 

PI 43 PI PJ* 11 
I V 1 IF I 

piMapia 
47 17 I' P U 

« :: ii i; « 



42 42 
47 at 
H ip 
41 PC 

.17 B3 

■ I 11 

I HP 

■ 7 47 

II II 
I'- n 
17 47 

l< li 
fpi 2i 



fP 42 17 
PP pp M 

pi y ii 

PP 13 13 

a; 1= 3p 

21 li It 

AI It >FL 

IF II 17 

21 37 z: 

ill IH Ift 
IF 17*7 

3: if X 

i\ 41" if" 



i ft pi n pi 
3 JfT »f 

21 II 31 



*>ai 

:<- «l 
•mwi 

• I Ptl 

.1 . i 
FPItl 

4<i it 
31 31 
it II 
li 4f 
ii ir 
up; 
IC Ic- 

*> 17 

il jr 
34 it 

■ 7 17 

3i *f 



Pi 71 IP 

ip a i i p 

m i3« 

B 17 It 

-ii ;ia ai 

4. I. Il 

; If If 

r pii -ip 

V 47 17 
tFHn 

<u :*1 it,- 

Jt PE K 

A- » " P " 

Jl 43 31 



II I- II II IP »:■ 

ai •: «i ii ti m 
af l! tJ3 Hi 33 ir 
IF Ji LI 17 |3 V 
■ PHitlli 

IF a II a - p» » 
» IF Ji T 3T || 
H H IP HUM 
IF JIIF T3FJT 

» >: |J -7 a* 14 
Il a li ri it ii 
13 li 17 I F X 
XlJlTllt 

if i ii f ti n 
n h ti i3 ij u 

I- u. .i- I ... I 

W Jf 31 p ie r 

13 41 13 tl PJ PJ 
)» 71 .3 !4 31 Ji 

PI Fl M I 

1] 4! 11 I' (1 t! 

«n || P nil 

11 !i II 1 *> tl 

It ■' I" »■ C I! 

" » » » rt ■■' 

34) 13 1> il .11 Pi 

70 M 41 f 3F 4 7 

Kit) U 49*3 

19, I F I J tl Ml III 
PP *» I • It IP, 171 
HW 17 47 U 
it it IS- II IA 111 

I!> )' |i> «i 4w io 

It? *>F 4> 17 if t-7 

•7 ji *j ii aa it 

II 3 |F • 11 It 

33 u pi 17 17 42 

17 41 (7 1? f| ff 

7> 4 * 51 3 Jl 

14 31 || fi M It 
as i< 19 if t; *3 
it M ii n i i 

V N It I) li II 
Itltlt II ti 41 

j* p it ii at ii 

■I - il U if, jp 

J9 ti 12 I) ft «■ 

t> « IT )) H 17 
li Pf Htf >! m-i 

JF. 1' - F J P. P- f 

*t 4» *i 43 ti 4* 

J< 1 Wnn .u 
43 2T 3tJ 34 tl 3P 

ppp p. Pi pp-p PI p-7 p?j PP 

Enicpp. xtm 

51iVT.771| 

inn. i:» 

srpvpiiiTi 

■til v v liHir Uiliipi 

IF 13 3* tf F l| it i; H / i| 

n n i.i .1 i i- mi tt <pjii itp i] 

P~ V IF pi Fl 11 |A p| 11 II 11 

1-PI 'I 3li "* PV m t S ]P M Jp H 

jf » 13 t: ii }3 ;i jj ti «a jt 

a. it m in 'it at ii f it t u 

CO FF ir IF w pf 1 1 1*1. u 

LHLLP. -*.! 



P H Jf 

DHH 

I II .* 

pi I 14 Ai 
PL II PI 

i: 3t i: 

9 3F3E 
41*7*3 
31 If Jt 

III i p 

m t3 i: 

A3 t3 PA 

ii Tf jp 

UK AI TF 
17 11 P3 
3 33 28 

id jb ■! 

•L *4 OS 

p n- 
rati 
e- 13 13 

*F *v . i 
I ■ l& it 
Li ID «.! 

tH 4J47 
U H 17 
l> 13 13 
17 17 PJ- 
13 Li 33 
li 73 t* 

17 13 in 

Jl U L4 
3F tJF LtJ 

t? 13 t? 

If IF 11 

1 It- ■ -I 
ft IC H 

» 13 *i 

:fj j-- i r 

Ml II H 

M 17 IZ 
«F 3t 11 

■ 17 II 

pIf ai 17 
H H Jf 
MI7 7I 

V li-ti 



2* 

HI 




THE FAMILY FAVOURITES 




EMPIR 









.■yrrki r*vi 
I ■' 'k - ii 



-&p» ; liw^V- 



EI>:,TI.0YBI,(: 
DRAWWANDVCOCO 

CBMW'AWSm^Ooiji/rht 



H)L1 P:\RT EUL"C\rH>>.\L 
4I,\KMHK£ 

">J Jf(l | pj>rp j « pp. nfitm •tftifnt 
j , pptiA«*iv»iWif4lnfi. " 
Hlf* tln-tSifrF 

" I l^ll PlBWlf iFilpi-.tllPHjp JnFlPjr iHTI 

pp|J^HFaTlMPiTV>f J i-fp- J ;j|pltl l ?iFi r 

jtfjrjf- il»irl('Jiii''TV , * 1 ' M " 
pJp-iTPn I ..f 



spiaRin-Hk, 

(SM 64 

£9.95 

EPIC 

I 01 IIIWII I' 

HMJJ.V 

"ImLttlir tttl lltll^PlfAMllo, 

^llF^p.JlJi-iJpi'irjtrtfrapil'iiTh 
1 i i ijip . ii. pf jp-pF*! j W iViliFlpri. 

BUT, 

" If p-VpvUilpJ»jr rrtVjv ... p titPT 

pjf-.iJTi.F-Jii i&ii.iM>t 

'ftPH-BUppPlvt' IS Tl 




CUM 6 1. 

DMGOWTANDTCOCC 

COLOL'RFILGAMEOF 

WORLDWIDE 

^TRATECV. 

iiVtrpiTiii'* nr -nrATDf " 

IIjVitYuplplirt 
-Yvtt/ui.'rHi-pjppl.ir' 
■im.iVpvt-iJjPiFi.- j.-,.»i 

. J,||K . 

.1 H .FJ. Il ft 



mam \i ^k 

£,1.71) 

OTENSR'E 
ILLUtTRVFJiP 



AI'VIiVTl'RL 

-^■rJp/>|J^jiM Hk-l-l 

PCS 



pal 

sPBCTRLlMlflt 

BRr'EliECTROXfMnrhi 

£5,75 

FULL LTfUTirREfi 

EDUCATIONAL 
ADVEMIRE. 

" I j3-prJp. pfUlfuf JlF.rtlgH' jlJr 

ppfrpVlpJiT'. 

'ipvltalFT 

~7V-in*Fjm/,^FJtiili>fFi->j>f 

PAP>FFpnjfP|«P*il PP u/"K 

UpfsfjiniirfVirai ~ 

ii :\. 



AVAILABLE NOW FROM 
SELEC1EU BRANCHES OF BOOTS 
AND ALL GOOD STOCKISTS 

or by mail order, using the coupon. 



Tf ^Hinn-iWIl-TVVAFF. IWFTflrJiWAri I pWnjWKfiFapttj'i^ 

9 ease tvvi me a top* of (plessse ,ek ) Ptrttigr en Chronicles " 

Empire □ Galilea \~\ Jend-o Road [ | Uy$:4ry oi !he Jsva Smf ~ 

Wy nrmpi Im rt 

^45mt= 

AMress 






Prjas j rjpJbii my ACC ESa^iSA Accour i.fvCNo , , 

(w prt>n»}0 f-51 4 *871 Io javetimej J inclese * Cttt^>iVTOfemKsvn» 

»C.t - rrutfepiyarji, to SHARDS SOFTWARE 

sand - - - - _ 



YOUfl COMPUTE F h MARCH 190S 81 









Program 2. 

2710 7F2D497F2D4A10BE 

2718 060010BF2D4310BF 

2720 2D4/1MH11E0EIBBF 

272B 2D451 7B2!:cgEB4A2 

2730 9F8B8E2D&2BD90E5 

2738 17021F27FB9E8B30 

2740 02A 78431 592 /W/tfl 

2746 4E26ED1702BB86:E 

2750 Pl7 7FI4 7RF 714HK I 70? 

2758 0A1704-F17B1C5:7 

2760 02C31731-527F58J 

276S 0^102/4-5/' IB 10926 

27 70 1 38C 5- F 27E6E 7 80 

2778 10BE2D43312H0BF 

27 80 2 D432 D5S 1 8826 1 5 

27BE BC040027CFE7B430 

2790 1F10BEZD43313F10 

2798 BF2D43203CB15E26 

2 7 AC 398C34 2025 1 2E7 84 

27 At 308BE0103E2D4331 
27B2 A8E0103F2D4320A1 
2 71(0 10BEZD4 710BCO6B0 
27C0 279A3 1 ASE0 1 0BF2D 
27CB 4710BE2D4331A8E0 
27D0 10BF2D4317023C16 
27DS FF7FB10A263CSC05 
27E0 DF2213C7O430QD20 
27E8 10BE2D4331AS20J0 
27F0 BF2D4316FF63tBBE 
27FB 2D4710BC1BFF1024 
2800 FF5A31AB2010BF2D 
2808 17iO0E2D433tA920 
2810 10BF2D43L701FC16 
2818 ~F3FB10C26061700 
2B20 EFt6FF35BiSP26B5 
2B2S 3D35 I 6FF2C8 1 1 526 
2830 358 D 4 2 J 6FF23815F 
2B3S 260617022E16FF19 

2B40 315B2609:7B24C17 

284H IfllLVlfaH-atJB 11326 

2850 0834141704681603 

2HSR gnSD^r. AFFFB19 10 

2860 BE2D45A6A2A72110 

2B68 3C2D4326F68660G7 

2870 A4 1 7tf 1 Vh ^V i 0BE2D 

2878 43A621A7A010FC2D 

28 80 4526F6R6A0R7ir>FF 
2838 17018B39E78410BE 
2890 2D4310BC1DDF220E 
2S9B 30013121 JF10C41F 
28A0 26F610BF2D433934 
28A8 06810D26B4SDDD20 
2BB0 31812025404D2B0C 
2898 8140250681602504 
2QC0 B4DFBB<*0fi7E010BE 
2BCQ 2D43108C1DFF250C 

28D0 270430 1F20OCA7A4 

28D8 301F2006P7A010BF 

2BE0 2D43QC03FF232710 

28ES BE2D''7i0eClEFF24 

28F0 0731AB2010BF2D47 

28F B : 70 1 1 B8EB5E0200E 

2900 8660 A 7 80 1 0BE 2D43 

2900 A7 A0 1 0BF 2D43 3586 

29 IB 31;010BE2D4T-O£,i0 
29 IB A7B0A7A01F10C41F 
2920 26F435903410BD02 
292B 35907 A2D42260B8i 
2930 3CB72D42A684BB40 
?93;R A7B48EO3203GUF26 
2940 FC39F6FFC0CA807O 
2948 FFB22BB2CA4039CS 
2950 />F7FF02F6FF00C4 
2 95B 403 934 1 4 BD03 4D35 
2960 94327E£F01^17FFF 



289 
214 

IFF 

24 B 
476 
2B0 
2B6 

2D 6 
1D1 
2C8 
36F 
15E 
M7 

25 F 
22*5 
321 
J DC 
310 
28E 
307 
3BB 
1E4 
376 
33E 
1AA 
2FG 
3C7 
247 
375 
25E 
34E 
27E 
269 
20 E 
342 
2BF 
2EC 
1A1 

1B7 
2A5 

EF 

3CE 

350 

'r>h 

28 F 
34A 
41 A 
312 
238 
I 95 
2Cfl 
24 fi 
1"6 
1-6 

259 
1F1 
23B 

25A 
30C 
243 
1D1 
34 B 
341 

26 D 
380 
2B2 
265 
354 
251 
4F1 
337 
530 
133 
3A2 




296E 
2970 

25 7E 
298 B 

2^ae 

2S90 
2998 
29A0 
29AS 
25B0 
29BB 
29C0 
29CB 
?9r>0 
29 D B 
29E0 
2 VLB 
29F0 
29F8 
2A00 
2A0B 
2A10 
2A1B 
2A20 
2A28 
2A30 
2A3B 
2A40 
2A48 
2A50 
2A58 
2 A LB 
2Ai>8 
2A70 
2A78 
2AB0 
2A0D 
2A90 
2A9B 
2AA0 
2AAB 
2A30 
2AB8 
2AC0 
2AC8 
2A30 
7A1R 



02F6FF00CAS0F 1 34 
27721 F9B7 3FF02RD 
C9C1FF2667A7806F 
E4CtFEF7FFH23DBA 
E761E8S4E484A661 
A7B05D260A6CE443 
79FF0225E920459E 
97BD9AIE898D9BE1 
6 1 1 E992&37 A6C 4 80 
088B085424FB4D27 
32aiac2517SM 125 
28B12A22228B30SD 
8627127D0149260D 
8A202O0 I 7BB301 7FF 
7626028 01 081 1226 
047331 494F35 B 0B0 
1 A300B48 I 7FF6026 
014C8E2D26A6B620 
F4nA^0RFfl4O0E:7S0 
BCB5 FF ? 3 F939 B E06 
00B660A7808C1E01 
26F939 1 BBhVUt /LJb 

4 00 A6 A A 7 H0 )1 83 
060 026F 6^934 1 ^7n 
2049261 FB6FF00B A 
COB 1 FF2 6057F2 D4 A 
202FTC 2 D4 AB62 D4H 
3164252586FFE72D 
49201E7FFFO2B6FF 
00HAC0B1FF26057F 
2D49200DBE01S1B6 
rr5FA7B?33CCie023 
F9359634 J 08D=E 10 
BClDDF22tBfi6A820 
A7A0 1 08C 1 DDF23F5 
CE1DE06660A7C011 
OZl C0026FO35 101 7 
FFB13934J0BD3631 
AB20i0BF2D4B10BC 
1DFF2213108E1DFF 
A6A8E0A7A410BC2D 
4 B 230 4 3 1 3r20F 1 FE 
2D 43 1 0BE2D4B3 1 AS 
E010BF2D4317FE4B 
FF2D43359010BE2D 
431F20C41F27063I 
1F30 1 F20F 43934 1 4 



M 

351 

4AC 

5E7 

523 

347 

38E 

46E 

36r 

2B2 

1B2 

25F 

1B9 

2A4 

IE7 

155 

2B9 

27A 
403 

379 
2BP 
368 
345 
772 
2FA 
361 
Zfah 
390 
3BC 
374 
VW> 
3D2 
303 
330 
3~7 
429 
21B 
2F1 
2AB 
30 B 
472 
2Ft 
2BF 
37C 
32F 
133 
223 



FEATUKKS Of Wofdpr^f ildndc 



I f ui auto repeal on keys. 

1 3K V 100 o&rcent machine c.<\(\r 

l3tcwes four separate fil^ each eH4 

*haraclef.i in l&ngtti. 
I Files can be swapped. 
[Automatic scrolling through text. 
(Complete on screen editing, 
I Search through a f|fw fui d siring. 
1 3vfnp to Drinter wUh double wWth or 

noma!. 
! -nes can be saved .o tape from Baste. 



2AE0 l7rriGCC04a39FQ3 2T5 

2AE8 8E2D75BD90E53514 3AB 

2AF0 BD295A27FBS13I 10 324 

2AFB 27B103B132273E81 1C4 

2800 3377 i7B 134270081 1DB 

2B08 3510:700FE8i3i,2f, 247 

?B10 DF1600E417FEFC16 400 

2B3B FBF6341 48600 BOS0 409 

2B20 0C863EBD800C9EBQ 33F 

2B28 BF2D4B170136C101 247 

7B30 1O27e0C2170iefll7 1B2 

^B3B FFD91600B9B6F |r 22 47D 

2B40 B501102600B21EIBE 23C 

^B+« 2D4310BF2D4B3414 IFF 

2B50 17FEP6BE2EE6BD90 4AA 

7*58 E5I7FDFE27FBB159 4F3 

2860 260BE62D62BDB30F 2PF 

2B6B 200AB14E26EBB62D 2ED 

JB/0 61HDH00I- 17FEB2BE 3B2 

2B78 2EB3BD90E5BD3B10 3BB 

2B80 BE060010BF2D4 7A6 7711 

2BB8 fl08 160 2604B 62020 271 

2B40 0EB161 2504804020 1F9 

2B9B B6E1 lF2202QB6aBD 272 

2BA0 B00F 10BC2O4B2437 22E 

2BA8 ene9I7FDAD810327 302 

2BB0 2E20D41F20C41F27 268 

2BB8 C139B60DBD800FFE 317 

2PC0 2Dl71lB3lBrr2416 25C 



A? VCRlR "OfJlPLrER, MARCH lOfli 




DRAGON 
ORDPROF 



Simon Tully and a 
machine^codc word- 
processing program 
for the Dragon. 




1>m is typed in ibe normal way wiiti umo 
key repeal if a key i= depressed for two 
seconds. You control the cursor wiib the ar- 
row keys. To insert a single character from the 
cursor use Shift said right arrow ksy together. 



2BC8 33C820FF2D47FE2D 3B9 

2BD0 4333CB20FF2D4334 301 

2BDS 2017FE373520378D 207 

2BE0 D93514BE040010BE 252 

2EES 0£,a01BDr2D47iaDi~ 21G 

2BF0 2D4320048DC43514 22E 

2BFS 17FE1B16FB5B8E2D 354 

2C00 E9fi6G02705BD9a0C 384 

2 COS 20F 7 39 1 7FDE B BE04 3E1 

2C10 009FGQGE2E97BD9a 3C7 

2CIQ E517FD3E27FBB132 40C 

2C20 2605BE32G82B10B1 264 

2C28 332605BE4AC92007 226 

2C30 B13426E5BE62CA10 38 A 

2C3Q GE0&<?0A£>B4E£>A1E7 42F 

2C40 B0A7601B8C1E0326 2A7 

2C48 F28E040010BE0S00 228 

2C50 10BF2D4310BF2D47 282 

2C58 16FF9DE6B4C940E7 50B 

2CbB> B4Ca4039BE2D4DCSi 393 

2C68 01BDE505Bi0B2b07 22E 

2C70 5A27F1301F204581 2A7 

2C/S 1326BA5A27E 63603 Z3fl 



ZC80 


BDB54A20F6ei0D26 


386 


7CSB 


a44F*F8439R1 ?717 , 5 


245 


2C90 


DB2209S660A7B0B6 


396 


2C98 


205C2020B17B24C9 


2A5 


2 CAS 


B72D4B4D2B0CB1 40 


274 


2CA9 


250661602504840= 


29B 



To delete use Shift and left arrow key. To 
insert whole lines use Shift and down arrow 
Jwy.- To delete whole l\nt& use Shi ft anc up ar- 
row. Shift and put you imo Iqnmsi >.ust — 
greert On blick - as normal. The dear key 
deletes froni the cursor to the end of tie line. 

Each file is ! 2 screens hi le.igta — 61 44 
chara:TCTS. 

Pressing die break kcj; gives you a m?nu 
wth single key com minds, Pressing key 1 ex- 
its the program and enables vou :o sive Jilts to 
tape is per addresses displayed. 

Pressing key 1 dumps current file to primer 
up lu lite \ ui-iul pusu.uij. Make suit tie cur- 
sor is placet, ar the end of text required.. 

Pressing key 3 if a starch facility which re- 
quires you K3 enter a target string cf up in 19 
characters in length. 

The &cai J i is |jeiibiu>cd horn he arsor 
position plus one tn ibe end of the tile. If the 
largei string is hoi found the L'uisor returns to 
the beginning of text else the cursor is placed 
on the target string, Pressing Shift ;:ud @ con- 
tinues seaidi fur any reoccurrence of [he 
taiFgqi string. 

Pressing key 4 clears the current file. Ac- 
cidental presses of ;liis key can b^ ccrrec'red by 
pressing V to the question "olti tSitrJ (\ or 

Pressing key jgivesyoj the ijpiion to swap 
the current file wi:h any of the other thr«, 

Pressing key 6 just rcrurr.s from menu to 
the current position in test. I 

2C8« B840CU424B3A7B0 399 

2CB8 5CB62O4EBDB54A20 366 

2CCB AB10BE2E433121B6 2EE 

2CC8 2D4DA3A<Z270B10BC 286 

2CDB iE0025r6203EBE2D 252 

2CDB 4E10BF2E4BA6B027 2E2 

2CEB 0BA1A*2£E2312120 2C7 

2CEB F410BE2E4B313FJ.0 2Bfl 

22F0 BF2D4317FDD710BC 3B6 

2CFB 1C1F230531A0E020 23C 

2D0B F510BF2E47FC2D43 3A4 

2DOB B32D471F0 1306904 204 

2D 10 00AF6339SE0400AF 2SC 

2D 18 63l0BE0d00I0BF2D 203 

2D20 43i0BF2E473930i2 20t 

2D2B 2C3C2B3E2E3E2F3F 1AC 

2D30 4Bi35E5FBP560B15 192 

203 B 95D 2 200 D0DO C5C 1 28 

2D40 030336060£;1E0006 6B 

7D4R GUKa000B£Z0B00000 2h 

2L750 000 000 0000 000000 

2D5B 0000000000000000 

2t>60 000F0E4F4C442054 170 

2D6B 4 5585 4 3F2 0285920 1F1 

21>?0 4F52704F2«J00^17F 197 

2D7B 2020204558495420 1 BA 

2DB0 50524F4752414D20 238 

2DSB BD3ZZEZ0Ze2133<n52 I feh 

2390 494E5*2e4F555420 223 



Program 1. 

is as 

m ItPUT"S-RPT R»RE3S"l3T* W.IW 

^S PRI>flHE50«3T^" "J 
m L1HE1MPUTM 

m F0Pl=tTCLEK^^TFP2 

m ai=co+v«j "w+p'j - 

123 hEXIt 

n^ LrHnwvreHf 

\A% IFnHSOHE^Cnf) '<■ THFWPJflHT'^r^r 

163 rriTn*m 



2D98 


2G222E0D332E2020 


:0E 


2DA0 


2046494E44204 1 20 


:C2 


2DAB 


535452494E470D34 


2 IS 


2DB0 


2E202020434C454 1 


1A3 


2 DBS 


52204D454D4r52S9 


24B 


2DC0 


200E352E20202053 


143 ! 


2DC8 


574 1 502042 4 C 4F43 


228 



2D DO 4E53 20200 D362E 20 

2DD8 202052455455524E 

2DE0 2020 20 202 1320 2 BOD 

2DE8 000E544F20534 1 56 

2DF» 4?2e544358542046 

2DF8 494C453A0D424C4F 

2E00 434E0D3153542E53 

2E0S S44I52543D3 13533 

2E10 362020454E443DT7 

2E18 3638300D324E442E 

2E20 53544152543D3I33 

2E28 3E303020454E443D 

2E30 313S3134340D3352 

2E3B 442E53544152543D 

2E40 313931343520454E 

2E4S 443D32353Z3B390D 

2E50 3454482ES3544152 

2E5B 543 E 32353 239 3020 

2E60 454E443D333 13433 

2E68 34BE43534156454D 

2E 70 ZZ 4 E4 1 4D4 3ZZZ C 3 3 

2E78 544152542E454E44 

2EB0 2C300E007072696E 

2E89 74696E&72069&E20 

2E90 70726F6365737300 

2E99 53574 13020315354 

2EA0 20424C4F434B2057 

2EA8 49544B3A0D4B4559 

2EB0 203220202020324E 

2EB8 442E424C4F434B0D 

ZEC0 4E45592033202020 

2EC8 2033524420424C4F 

2ED0 434 E0D4B4559 2034 

2EDB 2020202034544820 

2EE0 424C4F434B0D0044 

2EEff 4F20594F55Z05741 

2EF0 4E5420444F55424C 

2EFB 4520574944544B3F 

2F-0U WUZKS^ZtMI-bZ/H*^ 

2F0B 2900FFFFFFFFFFFF 



I6F 
220 
ED 

:ba 

210 

:fe 
1F4 
211 

;c: 

19D 
22F 
:C4 
195 
23D 
1B7 
.9B 
238 
1B3 
IDF 
200 
iE^ 
23E 
222 
2C9 
2FF 

202 
215 
152 
IDC 
19C 
.hi, 

:db 
:/b 

SBC 

224 
23 B 
224 
1BJJ 
623 



VOUR COMPUTER, MARCH 1385 83 



'Engi nes on., .check, , . 

flaps to 10 degrees... 

\ check... increase 

J throttle, release 

' brakes. Increase 

throttle to full power 

...watch air speed 

indicator. Aircraft 

taxiing, increasing 

speed. ,.170 knots... 

rotate, observe 

vertical speed 

indicator... 

increase elevator 

angle. 

Take off achieved!' 




The excitement of a 
DACC 747 take off fires the adrenalin 
j like no other computer simulation* The 3D 
pilot's view and full array of instrumentation 
challenges you to take the role of piloting a 
Jumbo Jet,, .and once in control and taxiing down 
the runway, there's no turning back. 

Takeoff achieved. Full flying control at your 
fingertips and seven British Air ports to fly to.,. the 
drama of landing is waiting to unfold as you sit in 
the hot seat of a 747 flight deck, 

Ov , J , ifii'i'!(T'dirtfirni"'!*'' , n rmlihl vilk * mii^i^.- ■"n^ippnt *s-. s-r^sm - . I — ■ I >_ ■ c s ■c^dovdib'ta'cri f »i'»ta>!. 

■« 1 Dl* ir ilf pfrio?'.-l¥e Ml r D^V Drfrjnd bndlrq QM M "JS-C D J \&fitVkt 

CQfH*V F*i*f M 1 fl^ ll- r II ■► iq VAf-nl |iii-lIiii|<i ^["■''1 * Fr •■ p(7 ?' ^gni-igd?! 1 ? 5« Qf|l 3 nC'I Cll.^Si 

747 FLIGHT 
SIMULATOR 
FROM DACC 






©LIMITED® 



Mams gotoeKtxrnq 

Address 1 — 



To:UACCLld.(Dcpl,YC4). 

53 Waverlejf Road, I Uncle v, 
Wigom, Lancashire WN2 3BM. 



The leaders in Flight Simulation. 



Csurly P-ostode 

Pleusescndrnc ,. . , copies of iJieOACCWFlighl 

Simulolc-r a' . . , , .,.,,, 

I I encosecheqieV'PosiDl Order for tie total of , 

■ My computer is a , , .,, ,, . 

IM dwilv ■MuuKMlu»wk'it9iiL<w4g.!MlC*OJUm $M ( 1i tovH.»*m#ft*«l,Cyleh** J l««rin«n 



M^itf* 



This article i> not a compilative icvievt in 
the usual sense* Ectb of the languages are 
Kojd jnd complete irrplcsncnlalions aid tny 
main purpose is to compare the uses to which 
yo'j may put rh;m. net to recommend a best 
buy. The ADF. sysxivt if downed an J 
marketed by $ysicm b 2 Collegiate Cresctnt, 
Sheffold and BCPL is an Acurmofi: language. 
ADE; \n ordinary fssembier produces one 
machine-.'tid; instruction .n toe object aide — 

ill* UUcIfiue tuic lllitl W.1I LVllUV] lilt L'.'lll- 

puter — far each line of sou ret cede — the 
jmtrucikms thai you type into the computer. 
That :s alow level laii^ua^- Basic, of ECPL, 
or Forth ire hig.i level languages because each 
instruction that you type may make ihe com- 
puter carry out hundreds or ■hojsunds of 
machine ;od- trstructions. The Basic instruc- 
tion X = SQR(Y), for example, would lequirc 
at least a pa^e of instmctians if it was written 
JuWJJ ill LUUlIjuic: luJc ui UsMfmbJci . 

A macro asscmbkr lies wmewhen: between 
the ordinary low level assembly lart^uai^e and 

the familiar bigh. level languages, A "macro" 1 
is i set of low level instructions that you have 
written far youj own ymyuKk which yuu ,uti 
insert into the ahjcit code program simply by 
typing the nam* of ihe macro into rhe source 
coie, 

Once the macro is written it C*n CO put into 

j libii ty .Hid tjkcii juland iiizd whenever /uu 

wish. In other words you «n build a set of 
his.h level inspections to youi own Jousi and 
fii thun ,ntc pUcc in your p-oij^rns iiist ike 
Uttic commands. 

.\DH is £>up|flicl will, a di:L lutuaiuiu^ 
ui litv and demorrstiatiun programs. The 
demon st ration is impressive and the SYSL1S 
fib has a number of use fid macro dcfir.it ions, 
For example, figure J lists macros that will 

SCIlJ 111 I'X. Ui Ulk jXCIllk (.IHllllllllld !U lllL" 

machine opirat.ng system, aid handle an er- 
ror in your program. 




onn Dawson takes 
a look at two languages 
for the BBC. 



BBC ADE 

BCPL 




Each of the macro definitions is well 
doeimtnitd and you should be able o $;c 
how easy it is to create your own high level 

iuStrUClionS. PjjajucltLi am .iilaci I hill iim 

pasted from l he nam program into a, macro sr 
a subroutine. Parameter posing is very 




important since u determines ihe usefulness 
of any knguagc, rot just assembler. 
The ADE macro assembler has good 

facilities to pasi parameters into macros. The 
Error macro shows -low a number may be 
used in the source code and, ilso^ how the 
address; afa suing can be passed. 

"The h pEtt of ADE is a sophisticated teat 
edited for p.tpiiiug u.ttl aiqdifyuig lt« VUUlCt 
code. Kith package that appeals l.as to have 
iti own ,'diior; BCPL has two, one Iftrge and 
one tiny, and Mulii-Farth 82 has another. It is 
a complex job t ryinje to learn three or Too" 
d It'ercnt sets crediting key Quctioua aud 1 tr* 
ic use View for all my source cods editing. 

Each ui' tLie others has advantages — better 
p-inrer control, nor; advanced teamch and 
replace fad. tries — Utter bbek moves and so 
©a — btt they take s<j long to louk uji ui tU* 
rranuals that you use more time than you 
leve. 

In ADITs defence 1 mtst say ;hat th: editor 
■ ircludes all the facilities you might reed for 
\mik! |ji<itcsiki^ although i"te unuuimidv.ure 
ai a C0ff.parati*el> Jcr.v level. Nevertheless, it 
can be used for e^neral-purpose text prepar- 
ation, &.\i ADE manual was written with the 
editor for example, and you could do much 
Worse than io MuuduiiJi^e uu iht ADEiVitciu. 
This is particularly true since ADF have 
rewntten the editor to work in an 80-column 
mode ar.d with ih? second proce$$ar. 

The third part sf the ADE paciog; is the 
SPY liotiii panel u.miitor "Frt'nt panel " 
refer j to the days — about six yeirs ago! — 
when rncrocemputerg, and bie PDP mini* 
computers as well, displayed the internal it at; 
(continued on next page) 



YOUft COMPUTrR, fylAftCH l£$5 S5 



(continued fiorr. previous page) 
af the nin:hinc on jcrricd ranlci of Lights on 
she fnini panel Faef light represented a 
biniry bit in in interna register cr balTcr and 
the state of each bit could be altered iy 
squally serried links of switches. 

SPY Liu be ciLtcicd from a luuni.ig 
program i>r from the command state, The 
front t^ttcl monitor commands si low you to 
view t. section of memory sitter from an 
»ddresi set by you cr from the program 

-JUUIllU. Tliii ni-aii> lllal IlL LUJICI.l ittli.HI 

:>( a machini cede program is listed in the 
memory block, You can jump luionmieadly to 

ihc address J"i>]](Vhvh g a JSR — Tamp lo slH- 
routint instruction — and search fo- a speci- 
fier Lf>lU pHLLUJl. 

Further cunimmds allow yttu to modify the 
:oments of memarv locations one at a time ot 
in blocks, shift btoch o'memory and compare 
the coatems 'if two blocks. Y^u mn alur the • 
6X2 icfciMciVj siugk-buep ;/mu my lUrt-ugh a 
program, coulinue running a program and 
si a it ciecutitm from a specified address. It's a 
good monitor. 

Comprehensive instructions 

ADE is completed by a comprehensive 
insiruction mam:al which is prop;rl> printed, 
well laid out with a sable of consents atid tin 
ind^und plentv of examples. 

The real diflcie-iKe I ..t-iwccn a ^ihxJ rnacto- 
jsscmbler and the Bask in icr prefer supplied 
witj. the BBC Microcomputer is exemplified 
ny the prrjgnm Listed in figure 2. I dislike 
jfltidy labels Or my floppy dis:s ind so I 
wmUeC lu print a kh nf labels in a standard 
format Figure J shows how the disc tides 
ippear when the? are printed on unfit-width 
wominuous sticky labels. 

it took tihuux 15 minutet to writs the 
i>tugiu.n in fguic £ f and i fartiier 15 or 20 
minutes to edit it ui[il [ achieve' I he layout 
;hai ] wanted. BasL: makes this type of jib 
:crribly easy. Ttc prcgram rcnuins in the 
computer all the time and can be summoned 
ap on to the screen for instant modification, 
speed is whnlly ur.impor:ant in this appli- 
cation. The number of lines to be printed can 
'x dtered very quickly until [lie program stays 
.n synchronisation wilEl the sticky labeL. 

All iif these things are mere difficult with jii 
assembler. A macro assembler scores heavily 
where yoj tre writing jour mvn sffvi*!- 
}urpose iiHcrpictcr, ;) prim fomumng 
iro^ram far example — there's one indudid 
n its suuree code form ttfllh ADE — high- 
speed data acquisition in a laboratory, text 
!iandlitiu programs for which Basic is less wHI 
suited 3 and so on. 



figure 1. Macro dettnmons 


frorr the ADESYSLiB library. 


*■••'• ■STAR* ****-' 






P issjc simple slur " commanrt 


: 3 parameters 


. eause orro' using BRK 


: 1 parameter. t?xl of comnsoU 


A f--g<*.l<?f ujlue 


; Iwo paramstore 


. CXtlTip CO 


;X register value 


; & 1 = fl'ror nufnlw 


; STAR BASIC 


;Y register value 


:^2=QTormeiSdoe 


; STAR .catalog 


.note values cin ho (KnreRRionR : i>*snnrii*s 




:as *8l as cor si ait s 


; ERROR 14r r ValuelM big 


: Neve posiiiqn ol CONT. sines 


i ain&mplfls 


fRPlOR MACRO 


; EN3M carnot have, a label 


: F>4 4,1jJ 


BRK 


STAS MAC^O 


; FX 200 MASK,: 


DFB ®1 


LDX E>.,L1 


FX MACRO 


ASC '^2' 


LDY £<L.L1 


LDA Eftfrl 


SRK 


JSR &FFF7 


LDX £@J 


ENOM 


JMP ..COMT 


LDV C$#3 




_L1 STR >Q" 


^SR iFFF4 




..CONT 


bNUM 




E^DM 



BCPL; This is a compiler langinge, unlike 
Basic, aid was written by Man in Kichards in 
1367, It has bc;n ; atsble language since about 
1S72 and rhe vers inn nfTp-ed for the BBC 
Micro [i j lull irrpiemeitalion oftht RCTL 
standard I r _-vel wi h toiM extensions and 
macbiitt spucislc procedures. 

A :ompilcr vorss lather like an assembler; 
after typing in the wnirce rnrlc fiw a pTjgram, 
toe language reads ihc instructions., checks 
their fw misiakes ond compiles an object 
program which wiil be jmallcr than the 
original source and w.tl run very quickly. Th* 
snurf^ (ThIc f'-ti hi* erased from the computer 
after storinf it on disc. 

The BBC versicn compiks the siurce t:od^ 
to an in' c mediate n>ic — Cintcooe — which 
is then .nicrpreted by the BCPL -torn. Thii 
half-way apprrflirh is lot the eo.Tiptort:i»c that 
it seirm and HBC BCPL dots otTer speed 
advantages over m already very fast Basic 
together wilh som^ portability between 
different machine v 

If 'he program rnrrw nut taamtmn m error 

when the object prt.grstn is executed; you 
nmst rekiad the source code, correct the error 
tuinu n woid piooewor or text editor, rctnm- 
pile the object code and try again. The 
lanx^apt yon tn- iking may or miy not give 
you in indication of vthetc the program faded 

BCPL uses compiler 

YVri r*ii w* rhnr a n lmoerof tilss hvtt t:> be 
loaded into the compute: during nc compil- 
ation process. 3CPL uses the compiler i sel' 
ar.d at least three other piogiams that txe resi- 
dent in menoiy at the same time or overlaid 
Tf yrwi want to debug, tliii program yau wil. 

need to bad ai xaxt one other file and possible 
two or three more 

I wouidnt try lo use lit;^! wthout one 
dbc drive aid Tor stfiout work l think you 3 ] 

nci'j't iwn Hrivei. Thif will aSlov y(su :o Ll'^c 
the compiler and the test programs on one 



CONCLUSIONS 

■ Once you hare become familiar wi h 
the BCPL anjtiitge progress, n 
programming wll be quilo Fas:. An 
additional llcalhg poini package is 
available containing triqono metric 
and logarithmic functions. While you 
require the 3CPL Rom to run the 
rntprmedtate cede produced by the 
BCPL compiler, you can obtain a 
program which producss stand-alone 

machine cod* which will ejfeco.e on 

either the BBC Micro or other 6502 
bas3d-machines. 

■ ~he ifcUHM jrite ;ut from £90 O 



Btsout ESC for ne standard bCHL 
system makes .he lartgiagc much 
more attractive for eKperimeniiof and 
learning. 

ADE is a superb macro assembler 
The great, advantage ol assemby 
languages for hesitani programmers 
like myself is that whiie progress is 
slower, at least you know what 6 
going en. 

Most ol the jebs that you might wart 
to do with asiei ibCf Idtiyuyyti could 
te done with BCPL bjt ADE is far 
cellar supported by all the assembly 
language boo«s wnlter lor the 6502 



drive, and source and cbje:E :»dj en he 
other. 

The user guide does explain ho*- you can 
separate- the development prpRTams; from 'he 
other atilitici for testing :he Ciitcode hur if 
you sim to ^rile a program of any size, and 
keep backup COptCi of the source aid object 
code, your disc will HI. up rapidly. 

ECFL is 3 bbelvFinieiur^d kngjage l.ke 
Pascal and Algol. The jyn'.ax of BCPL allows 
yot: to write well structured programs which 
do not use Goto .nstrucrinns or labeh. Indeed , 
the Goto .[isiuniion in BCPL wll enly work 

wilhin [i t'OrHpOfUUsely limited range. 

Calculates a new answer 

L/Ullke Basic, which separates data into 
numbers — integeis aid reals — and strings, 
BCPL makes no distinction ind you can 

happily add the letter G lo die number I 71 to 
produce a nonsense tetult. Th-s r.aivety on 
the part of ue language i. uetually very help- 
ful in mjny applications. 

Figure 4 shovs two declarations which act 
as a simple four function cHlculator on signed 
16 bit integers. The finaion — a procedure 
which rciurns a valut — "expression" 
declares :hrcc l^ca vtriajles and ther loops 
round th> block t»f commands following: 

until operator — '— 'do 
until the end of tie calculation \t reached. 
Every operaior that is read .akulaies a new 
answer which U eventually pissed hack lothe 
procedure "calculator" and primed 

It took ab*ui 15 2(1 hours bebrc I felt sny 
familiariry with BCl'L at all. The tisei guide 
supplied with ihu BCPI. ROM and floppy 
difc, is 450 pages .on&, packed with inform- 
al bn ind inniff.cieni an its own The manual 
state*: 

"The boo* BQfrtnng BCPL m rfa BBC 
Microcomputer hy Paul Martin published by 
Acornsof: piovides a suitable introduc'iori to 
the language." 

Thut nuy w^ll bf; so b\i: try and get hold of 
a copy before you believe it exists. 

BCPL is like the Skywave Multi-Perth S3 
package in that i: ontiim its cwn 0502 
assembler. Also, Lite MultiForih (i% BCPL 
ha i i be factUty to run more thnn ore lask 
simultaneously. The BCPL assembler 
produces rdocaiabk object code wh.ch car be 
loaded ar.d run at sny address. 
You cm write a source code program that will 
produce relccaubh undine code using the 
ADE ma:ro assembler but you need ts plan 
how you are going :o co litis very ctrefilly hi 
advance of starting to type. ■ 



I 



B6 VOUlCDMPUTER»MAHCHl9a5 



T 






_LJ- 



k_A. 



JJ 



KEVIN TOMS es now 




Available spectrum 48k £6.95 commodore 64 £7.95 

NOW for AMSTRADCPC464 £7.95 



SOFTWARE STAR is the NEW 
game from Kevin Toms, who 
designed the Software Classic - 
FOOTBALL MANAGER. 
SOFTWARE STAR allows yau to 
try your hand a! running a 
successful software company. You 
have to cope with staff problems, 



came launches, advertising, 
financial prob ems and more while 
trying to produce chart 
topping successful games. 
One other thing, SOFTWARE 
STAR has that gripping 
Addictive quoJity that all 
Kevin's games have! 





by KEVIN TOMS 



' Absorbing and realistic - Highly recommended" - Sunas/ v-mes. Feorvaiy IBM 
' Completely fantastic - I want one!" - Charts Nicholas, A/senal &fiterir< Big K,Ap1t19Q4 



Some outstanding Feature* of the gams 

• Transfer rvdrtot • Prtimciontindrekgaibn 

i F,A. Cupmalches • Injury p'obtame • Full eague tables 

• rcurClvlA'aris • Pick you - own tosipii tor <op£h match 

'• A9 many seasons 03 you like • Wandgertal ratlns 
7 sMl leves *Sa-;e gjmciacllty • HnoroalrnanlpiiaHoni 
* You can awn ba &adc©d' 



NEED WE SAY MORE 



FOOTBALL MANAGER 

is availably fo r lhe 1o lowing 
oonpulers:- 

AMSTRADCPC464, E7.95 

COMWODOFE64... £7.95 

SPECTRUM 4SK , E6.95 

ELECTRON C7.95 

BB-fcODELB C7.0S 

ORIC4BK&ATMOS £795 

DRAGON £5.95 

zxfli ieK 



'"»»f W1HIJJJII-I1I1 



VIC20+16K... 
(soon for MSX) 



£5 95 
£5 95 



iiabte from 



WHSM!TH$ and "4 



'selected titles) 



In case of difficulty buy by rr ail order. 

Send Cheques/P.O s to: - 

ADDICTIVE C AMES 

7a Richmond Hi I, Bournemouth, Dorset BH2 6HE 



VA wealth of Peripherals for your Spectrum!) 



ByRICKHHAVO 



Since the 48K Spectrum was bunched the opportunities it offered has attrac:ed peripheral manufacturers throughout 
the world. 

Or.e of these manufacturers was bound to emerge as the "brand leader" and in the case of the Spectrum this turned 
out to be DK'trorics. The company is based in Saffron vValden in Essex and proudly boasts a history dating back to 
:he ZX80, All the company's products are manufactured in England at their own factory and tney have now estab- 
lished themselves as world leaders, exporting to over 30 countries: 
3elow you will find a review of their range which now include* over 16 products, ail of which are available for the 



Spectrum and Spectrum f models. 

The DK Microdrive Compatible 
Keyboard is the best selling keyboard in 
the world and is now jsed by around 10% 
of all U,K, Spectrum owners. It is micro- 
drive compatible and offers more key 
functions than any other keyboard in Its 
price range. The stepped keys and space 
bar make it even eas;er to use- It is 
constructed from hiyh density black ABS 
and las 52k$ysand afu 1 width space bar 
A separate nuniei i<_ keypad of 12 red keys 
including single entry * delete' plus single 
entry 'decimal point" facilitate fasl 
numeric data ertry. 

From good computer shops everywhere 
at only £37.50 or direct from DK'tronics, 
add E 1.50 post & packing 



Keyboard 



Dual Port 





The first port simulates 6.7,8,9, 8r Keys, The second port 

simulates n (31) command. 

The E>ort will accept any Atari ;tyL<? joystick. 

It wi I run any software. That is:- 

ft Using K*y36,?,8,9&0 

(b) Having redefinable key in struct ions - 

(ct Using in «"31| (i.e. Kempston). 

This Dual Port interface interconnects w.th the existing 

range of DK'tron cs products to form the most com pre 

hensive range of Spectrum peripherals available from any 

manufacturer. 

From good computer shops everywhere at only £13,00 

or direct homDK'tronics, add £1 50 post & packing. 



This highly successful Light Pen for the Sinclair Spec- 
trum plugs neatly onto the rear of tie Computer or 
the rear of the printer connector. The operating soft- 
ware now runs faster and supports 16 predefined 
instructions. You can change all the colours (Border, 
Paper, ink), draw circles, arcs, boxes, lines and insert 
text onto the screen (ideal for diagrams etc,} Save & 
load completed or partly completed screens on:o or 
from the tape. 

There arc also features to draw, Ftet: Hand and animate 
on the 48K Spectrum, you can retain and an. mate 5 
screens. 

You car. also use the machine code on it= own in yoar 
nun programs for selecting out of a menu, playing 
games etc All entry points necessary arc given. The 
Pen works downtoptKftl leuel with pixel accuracy. 
From good computer shops everywhere at only £19.95 
or direct from DK'tronks. add £1 .50 post & packing. 



Light Pen 




From 



(K'tronks* 



Saffron Walden, Essex 

CB113AQ tel:(0799)26350 



3 Channel Sound Synthesizer 

Any microcomputer is capable of manufacturing sound, 
however, in order to produce a single octave 'C note with e 
frequency of 8372Hz the signal needs attention over I6 t 000 
times per second. 

To produce software capable of pcrfoming ju£t this one task 
would be difficult if not impossible, especially when you 
consider that to produce arcade type sreind effects requires 
even greater attention. 

The prndtrrtfnn of these souid effects without the constant 
attention of the processor is no* possible thanks to the AY 
Sound Chip, its flexibility makes it essential for a wide range 
cf applications including music synthesis and sound effects 
generation, continuing the monitoring and production of 
sound afler the initial command. 

More often than not realistic sounds require more than one 
effect and this function is prov:ded by 3 independently con- 
trolled channe s, as an example compare the sound produced 
by :he single note of X'with that p reduced by the chord *C 
and you will know just what I mean, likewise producing the 
sound of an explosion using all 3 channels gftes games a 
totally new dimension. ^_ 

Add to this the ability to alter the pitch tone and shape of the 
sound you have produced and it's flexibility is unlimited, 
In sirrple terms, imagine the note you have produced as a 
calm sea, by altering the pitch and shape you can produce 
waves, the top of the wave amtsspundi with the maximum 
volume and pitch of the note, which like Ihe wave ilself 
rises end falls. 

Programmable 




At last! A fully programmable joystick interface with 
feed tn rough connector that really works! 
Now vol can :ur ANY software from ANY supplier with 
the DK tromes fully programmable oystick interface. 
It comes complete wilh machine code software and can 
be programmed in seconds to give ful! 8 directorial joy- 
stick movements plus five capabilities and will accept any 
AtarL/Quickshot type joystick. A la. <s log ue is now avail - 
able showing the full range of products available from 
DK'tromca the world's leading Spectrum peripheral 
manufacturer The through connector enables other add- 
ons tc be plugged ir.to the rear. 

From good computer shops everywhere at only £22.95 
or direct From DK'tromca, add £1.50 post & packing. 




Speech Synthesizer 

The speech synthesizer uses the popular SLO/256 speech 
chip and has an almost infinite vocabulary. It is supplied 
with a text to speech converter for ease of speech output 
creation, Everything you wish to be spoken Is entered in 
normal English, without special control codes or characters, 
It is therefore extremely easy to use, The voicing of the 
words is completely user transparent and the computer can 
carry on its normal running of a program while the speech 
chip is talking. 

Although there are only 26 letters in the alphabet, letters 
have a totally different sound when used in different words, 
For example , the ' *a" in Hay is much longer and softer than 
in Hat. When you speak you automatically make adjust- 
ments because you know just how a word should sound. Not 
quite so easy with a computer. After looking at other speech 
synthesizers we declced that it was essential thai the 
DK'tronlcs Spectrum Speecn would offer a simple system 
that *ouM enable the user to produce realistic speech that 
was instancy recognisable. 

The solution to the problem was extremely complicated, it 
requited hours of programming to enable the computer to 
look at the individual letters that make up each word and 
compare their relative position to each other before deciding 
on th* appropriate sound 

I consider this to be the test Spectrum Speech Synthesizer 
on the maikel. From good computer shops everywhere at 
only £24.95 or direct from DK' tronics, add £1.50 post & 
packing 

Centronics 

The new Dk'tronics Parallel Centronics Interface will link 
your Spectrum to any printer with a standard Centronics 
Input. As the choice is vast, you can select the printer exactly 
suited to your needs. 

Features of the interface include: Rons all parrallel Cent- 
ronics type prhters: Controlling software fully relocatable: 
Interfaces with any software using the printer channel e.g. 
Tasword Dev Pack arc; LLtst Lprint recognised. High res 
screen di.mps; AL control codes allowed through tc printer; 
Fully mtorodiiwe compatible. 

Supplied w:th full instructions and controlling software. 
From good computer shops everywhere and sen$ib»y priced 
at only £39.95 or direct from DK'tionlcs. add £1.50 post 

& packing. 




ARTISTS 



AuriSTS Only t a drawing proyryii for ihc 
Artstrad. If offers line drawing, circle plot- 
ting, and airbrush facilities a< well j> routines 
lor saving a craving on tape or taktm a icreen 

dunp on a printer. Ytyi cjn mse 'he keyboard 

fir s joystick Kull instruct .v nt aru included in 
the program. 

As it standi the p-Qgram docs not illow you 
to change the JnJs and i J aper colours. It is 
reasonably well iTmaurcd, however, and you 
s^hr.ii t.- hive no trouble Hiding further op 
tio:is. These cOJld also inchdc a tret-hand 
drawing ratilily and i fill routine/ 




Wai Tsang 
turns your 
Am 3 trad 

into a Canvas. 



ID R-M»» ******* »••#«*-*** ••••«••♦•»• »»**■■# 

20 RrM-Froqr .niilKTISTS DNLV 

30 REM»A utility cr lomathinq to da qi * rainy day*- 
■40 Rin'By Wai Tsang a net HtlPHS SOfT* 
5fl Rirt»2Wl2,'G4 tc 1/1/B5,! *m» 

i.0 R£r1*Hritten »□ that it night qm*. publish* 

d in vOUR COHPurEP. » 

70 R£rllHt# *#•*»■»»■■ ■■*♦##*»****#**•*+ •#»•■* 
BO C_Si PRINT" Tlis prt)tjj .i<t> turns vour CFC 464 into A u 
orfcjnQ Sketch pad mth facllitiM such «*, an 3 (P BPIKM 
, a L INI" DPAWER, 1 routine wuch *rvableu you to dr.iw CIH 
ClES easi ly,4nd last but nqt le**t a RUBBER. " 
90 PfclNl :FRIHT" You i.iik dliD i*ve ¥cu ilf.iHinqt an 

(^i.'ri-LtE to be t iruflK-d later or to be kept arid \.sed 

in vou' ci*rt prugr ani, " 
liO PRHT" the final dr«wmg can be djmpeij to J r=nn 
t»r , To dn this or to j»»^* vew d .•■,l m«. gn i.^-,. '. 1 

t* pre5-s (E) And then fallow thf simple ytt or nD ques 

t III11S . " 

110 PR I^TsPR] NT ' If you are a sucker for your nwi mrk 
m- of art ,.md you don't have a printer thenyoij should 1 
Old the programs ontc the screen u'.iiu) PROGRAM 2 and 

then atolre your «*S,t*r piac fresh f roifl the t^pF 



120 LCCAIfc IB,24iPR INT "PRESS A KEY" 
1 30 IF iNKEf+v ->■■*■ THEN 140 ELSE 13B 
HH CLSrf*PlHT»" The ina:ruction« a-e sinplr-Paaition 

",H* littlt- uhiilc qriphii;s cursor to the place »hefc -/a 
U Mint thing,* to be and pfesl tie right ktv tu [liertf 

• the and*. ' 

iHB PPTNTirniKT" The cursor IS mo*eO u-.inq t-ie JOyfttk 
but it you pick the all k i-y lio.ir iJ apt ion then you U*P 
the nuiw<rii l-ry h*"I wtiure UP-0,RIGHT=4 , DDW+-2, LEFT-* 

LAB PRtNT" To set the position o<f .1 point err ta turn 
scuntthtrq on and of-f pre^s tltp FIREBUTTON on >DV>t>V S 
r if you're using the hey beard then or the miner Ic ■>• 
d press "5 r ." 

.70 PR[NT:Pft]NT" For th* diff«r*n: nudtc-s : t» L' ftjr 

UNE 0FAUER T C r for CIRCUS DRAUER.'A' for AIR l«US 
M, 'B - -for Cfrrt&5« and O to UUH. ■ 
:S» PfltNl- "he -size of tha PIR BRUS 
hanqad atinq tia UP and DJUN ARRQh 

Cluatcr." 

:90 LOCATE LB,2fl:PRlNT'PRESB A KEV'* 
381B IF lbK£Y*<>"" THEN 210 ELSE 2TO 

210 CLSsFRIHT" LaatLy tor the 5cri.-c>n dLins and the sa«e 
to Cassette pr*SS (OIUIT »nd you can -sill, return t 



s spray i ■ w 1 hi* c 

eifS on ih* cursor 



90 YOUR COMPUTER, MARCH IMS 



a yi-nir jrowixij ■»* *,(.■>' Mvmy lit U" y<Ju G* n takt a 

rest ^n^ load it in ] at^r fine then finish it," 

228 fRUT" lriLllllfllLly yuu. alflft uff <i U<ti LINE LRftU 

ING AL'jd^- uitfi the cursor ii the centre Qf trie ecre 

or,. ™ 

FSB I.OCQTE 10,15;PRIKT ,I FRESS ANY KEY TO f!TART H 

2^0 [F INkEYS< V" THFN ?50 FLSF '748 

258 HODE 1:1HK H, 27: INK 1,3: INK 2,26 

2419 GOBJB 1460 

273 LOCATE B,l:PniNT" (rCEYBDARD OR ( J) OYSTK. " 

2S0 LF INKEY;37l=0 THEN Lfii«ll:D;.= 14 : J!t=20: QX=4 :FK=12: 6 

U'O MB 

2"?e IF IMHE¥(4^}-C THEN UJ!^7£.= Di-73i JK-/A : 0*i-i'SiiF5''.-76» 

iJU I LI :iu 

300 30TTJ 2B0 

3:0 iREllB T4nKi ..OCATE 1 , 1 tPRlNyUDIVk ON pictlre stored 

UN 2A5SETTE (Y/N>™ 
320 IF INkE¥(43)=E THEM GLTSUE. 1460: LOAD" 'ART WOfVK " 1 SOT 
D 352 

33H IF INKEV(46)=B THEN GOTO 350 
3*0 30TO 320 
350 =5^=1B 

370 SOSUB 14601! LOCATE 1, I :PRINT H LIME DRAWER" 

3HB -DCATF 1 5 , 1 : RF INT "SET FIRST POINT * 

IVU DV.=H 

4 HO 3DSUB 143B 

410 5GBUB 1290 

420 GD5UB 1390:GO£LiB 1430 

430 .tfjtl.lt 1240 

440 GOidUB 1370 

450 IF INKC¥<rX)-e THEN GOTO 470 

4ci0 BO TO 400 

470 if uH-i THEN 60TD MB 

4tilfl ■*& rri:h7.=y7. 

ava n y.=i 

500 SOLND 1 , 5BB 

5L0 locpitf i5,iiP«iN"'*asT second phut* 

920 Ft* 6=1 TU J2U;NEXT 

530 GOTO 400 

540 MOVE aX ,=»■/. 

550 DR£W K5i,^V.,l 

DnH !■- :-i 

5^0 BOLND 1 ,200 

590 LOCATE 15, 1 : PF JN T,, SET FIRST FUINI " 

3SB FOH (-1 TD tWflaNEXT 

i,HB 1.0(0 400 

fcLB ' ■ »*-frfPi:<el brush r ilAtine-***** 

C. .J0 GGELJt 1460 

630 LOCATE t , I : PRJN T "A I ft CRUSH ' 

640 LOCATE LI . 1:PF'1N- "fi I " 

650 LOCATE 25, l!PRIN-"DIftfETER= , :L]CPTE 32,1:PH1NT ssE 

rnlO 5P^-=B 

6'0 Mlr'IJI- 1430 

iSK^ii^Jl+^iLDCPTE 32,1;PRINT ssK 



i5V;=s- J ?."';il-JCPTE 32, 1:F"RINT ss/. 



£jU0 IF INr.EV(0)=0 THLN 

■ IF isS/1H THFN -,rK-19 

6VB IF I MM Y!2>=0 THEN 

: IT «#*<3 THEN :.r.--. 

700 BOCUt' 1270 

710 SOEUB 12*0 

720 It- [NH'Y(I-V.)=a AND Spfc»8 THEN 0f»7 I i SOUND 1,200:LD 

CATE 11, J:RRIM- T "QN ": GOTO 730 ELSE I F tNKEV tPXJ *« AND 

5pV.=I IHtH 5i7.^i: iUUNU 1 T »BOiLtJI,A»t 1 - , - : l-'KINf - LH- 1- ■ : MJ 

R I =i TO 1301 NEXT i6O""0 Till 

7T-0 l.-HJtUH 13MS 

'MO It 1 =pS-l Tf*>l /BO I l-l *'?» 

- '.-I I ! i- r. i i n 3 

7r>0 rV,= IN" . <VHE>»5iV."' ' 5./r ' • ' , 

?7B r ?!{=■ ItJT ' {fi*£>***7. . - <ss7. / 2) I 
'iu FLC.TR r \,j 254, I 
790 Ml ■ 
B-30 BOTO 670 

BIB ' «+*++Ri.ibbLf fnutine*+**« 
820 SOSUB 146B 

G'O LOCATE l > l:PR:NT' , ERAStk":(.lXATE B, lrPRiNT'QFF " 
e*B r Lr-.-O 
850 GQSOB 1430 
Bi0 BDSUB 1290 
S7B Until IR 1 74(1 
B30 till SUB 1400:l.iUSUB 1430 

U9B IF INkEV(FXJ=B ftND rb'^B THEN r-fat=i:SOUW l,2Ba:FLl 
R 1*1 ID t50;NEXT:LOCATF B, 1 ; FRIN T 'I UJ -'iGOTO 900 E-SE 
1= INKLY<FV.> = AND rbK=l THEM rb7.=B:SQUMD 1 ,2001 LUJi'i H 

3,l;PftINT - 'I>F - ':FDR L«l TD iSB:NEKT: QOTD 900 
700 IF rbt-J THEN GOTH <?[B ELSE GCSUfi l^BtBOTG B50 
910 FCJfl vf-^2 TD 2 

92B MOVE sX-3,vV,+ vXi JRAW : If 3 ,yV.+ v7..2 
930 NEJ.T 

7A0 TOR w*=-? TO 2 

930 MOVE «^-3,vld+vK.:3R««l r/.+3,yK.*«v.,Li 
9S0 NEIT 
97« HUTU 6^0 

930 r *nt**Cir[ile tlr awing subroutine***** 
990 OOSUD 1460 
10BC LOCATE l T l:fRINT"EET CENTfiE CF CJRZi-E" 

131C QDSU3 124)0 

lSJ2e Gngin 143B 



1030 BQ51JB 1270 

IB4B GOBUB 1390:GQBLB :43B 

Iffija If IPfliEYtrxi "HI THEN LiS-«XiLfI-yi;3niJND J,2HC;LDC 

£TL" I , I I PRINT"GET CIRCUMFERENCE OF CIRCLE'sFQR 1=1 TO 

200:NE<T:GDTD JBB3 

1HAEI Rlftllh l.'Vfl 

107D GOTO 1B10 

108B 50SUS 1430 

109« BJiJUB t^90 

1100 6DSLB I24fl 

1110 GJULD l39fl:Q3SLB _43« 

1120 I- INKE¥<F?l)-a Th*N oh X=icT;:ov7t=/V.; SOUND l,2Be:UaC 

Hit" t T l :(-Kifl I "bh I UtJNI*ft Ut- til»-L,Lh "lUIIU llLiliJ 

1130 G3SLB 1398 

11 40 G3TC iaS0 

J ISO dlK=CKTS-o-AWfd3?.=(rwK— □y''- 

1 1 hO dlX=ABS ( dl V. ) : a:7.=ABStd2X > 

II /O r -HCh I < rJ I ^"2) + (dZI"2t J 

HBO F3R a\=l TD 3£>V 

11 90 DEG 

1200 P_0T oX.cylt, I 

(210 P^Ol c*X+r#CaS<A7::,cyX-tr*£]N(a7.1 , I 

ItTYAfr N-K I 

!230 G3TC 



9GB 

IF yTi< I THEN y?.= l 

IF r S 'BB THEN v%-1fll! 

IF k7.< J THEN xX=l 

IF x?:>i40 THEN *7.»&40 

RETLRN 

IF !NI<;EV( ! -tX)=0 THEN 

II IN>;K¥(JXt-H IHEN 

IF INKEY<iy.)=0 THEN 

Ir JNH.L¥t37.)"B THEN 

IF lNKE¥(i9)=0 

IF lNKEY(5B>---0 

ir 1NKCY<74>>-H 

IF JNK£YC62>i 

IF INKEY(f37>°0 THEN GQEUB 1 4 38 
3Blfl HtTUKN 

3VH '+Hi-i-#»6r»phic cursor rmitinet**" 
40B IF TES'(j4K t i^tJ«l THEN (i=l 
4 IB PLOT icl.yJt.Z 
-..v. id mi'-;n 

IF p=l THEN PLOT lX,yX«l ELBE FLOT xX,yX,B 

p=0 

r«CTllTRN 

LOCftTE l,liFftIHT" 



1 240 
J25B 

5 2*30 
I27fl 
12UD 
129B 
V10H 
1310 
13211 
1330 
134B 
.358 
.360 
:37fl 



1430 
.440 

1450 
.460 



/ji= ¥ m4 
^V. yX-4 
<X=kK-4 
i7.^X7.i4 
THEN b2(f 

IHI-'N HI L r 
TIEN 57E 
'S HILN OOP 
THEN GQEUB 



.540 



SME tY,Ui • 
1650: GOTO 15VV! 



OR (OCNTINUE" 



L470 RETURN 

1480 REM +OUrT,SAVE OR PRINT OUT* 

1493 EDSUB 1460 

I5B3 LDCftTF 1 ,1 iFRINT" SCREEN DUMP (V/N)" 

1513 IF :NKEY (431=0 TK^N LiOSUB 17a0:GDTO 1543 

1523 IF :NHCY(46>=0 THEN GOTO 

1533 EOTQ 1510 

L343 (EDSUB L-*iya 

1353 LOCATE 1 t I s FRIHT"2ABSETTE 

15fa0 IF :NKEY(43J=B IH£H GOSUB 

1 "i7?l IF "MkTFY (4A>=lfl 1H-W RHin 

L3B3 GOTO 1560 

1590 EOSUB 146B 

Uj0« LOCATE 1 ,1 :FRIHT"(A)NDTHER, (3) LIT. 

Iil0 IF :NKEY(69}=0 THEN CLSiBOTO 310 

\tt22 IF 7NKEY (67^=0 THEN 10ftSIC 

ia"ja if ;nkey (621=0 then return 

I 6.4H C-DTO 1 6 1 H 

l/ifjil FFM** raw-ette ^*ve #• 

1660 SPEED WH11E 1 

I673T C0"5i!IP I46B 

I6B3 EAVE '"ART WClRi; <' , & , SC HbB , b 40WB 

1690 RETURN 

1700 FEMt* 3cn>ur iJurti|>. ** 

1710 COSUB SAAB 

1720 EIM iy.(320) 

1730 piKln=413 

I74H FOR KK.-1 TD ZH 

1750 'pis; 3 n=piKln-14 

1763 FDR t% \ TO 31V 

i 7 7a r-n^im l Fi7Fi 

1 7B0 iV. ( : X> =p I7.+ F2"/^p3Xf p4V.f p5?i+p67.-»t> /I 

1 790 HEX 1 " 

1B0O FRIhll H-J,CHP4<:'7J tf.Hhl ( "j} :i:i*M2l CHi!t(A4J) 

1810 FDR jH'l TO 32Q:PfVIKT»e f rHR*(iHj*» )^sNEKT 

1B2B r^JWT#3,CHR*(i 1 C(320M 

1 B3B HE XT 

I H4B PRIN1 •W3,CHfi'*< 15) 

1B50 ERflSF iY. 

196B FETURN 

JR7B r. 1 Jt=TFST (11£»?,piKln j 

1580 p2i>TE3T<i?>2*pis*ln-2l*fi 

11590 C 3V.= TE5T!l7;»2,pi^lT 1 -+}*4 

1<M0 i-iv. ii JT(l^>2,piHln-*.»+fl 

1910 p 5V.= TEiT ( 1 )1»2 , pkI n-B> + 1 6 

I ..n pi* 1 11 'l 'l ■- '- ,ri : (I " tfl - •■ ■ 

197A1 C7V;=TE3T-1 "■ »S,pi i 1 11 - 1 -' - hA 

1 v-WT ».l 1'ihN 



YOJR OOWPUTER, MARCH t9S5 91 




Sinclair Basic is rather slow u say ihe i=asi. 

Myiewvti, in tumniot with most (ther 
machines Spectrum prolans become slower 
fli they increase in length., Thi< is a n-siilr of 
the way in which thj computer finds a litis 
when you mak; a rcA.rer.ee to i: t For instaaoe 
if you h:ive 3 program in memory md ih> 
computer comes across ilu siatemer.t Goto 
9999 it looks ml ihi* wry fir« linn of ih* pro- 
gram and asks itself "is this lire 9999?"'. the 
answer will be no so it will go onto the next 
tine ; n J ask [he same question. It will carry on 
doing ihis until it eventual I v finds 9W)9. 

Ev;n thoieb the Spertm-n hum* ihtcugh 
the lines ai a lightening Jswr rat? the length of 
the program ensuics that th.s cin slow a pro- 
gmm dtiA r n considerably., especially il ihc pro- 
grim makes frequent use afiaSNwitmts righ: 
at its end. One of the met rinds, iiwd tn combai 
tcis slowing cfTec: is to put important *ub- 
reuthes thst need to run at maximum speed 
at the start of the program and ess importan: 
routines, such as initialisation end data State- 
ments ntar the pnrf 

Although helpful thit method is by no 
means perfect. For mstmoe, what if you've 
got 3 lot of program that needs to Tin it nax- 
iraum speed, it can't ill be at the wart 

Secondly, it tends 10 be unnatural tn st-tTniTf 

iiogrami in this way, qioji people like to 



write propra ns in the same order as they are 
executed, i.e. initialisation rait Lies etc first. 
In most programs this slowing down elTeci 
ifrt*! too imsortam, but Bade ganes using 
animation of any sort are slow crough to sturi 
with without any additional speed reducing 
etttcis. 

There is, however, i. better way rf solvjig 
the problem that previmit rtii compute- from 
needing u go through the whole rigmarole of 
searching through the program for a par- 
ticular litie. Unce a program is Run tie ad- 
dresses of program lines in memory don't 
eheng*. Ii's snly Mehcn ynu idd CO ur cJ« a 
program etc, that any address changes sccur. 
Saj you nave a Goto '060 stitemerr in your 
program. Kvtry time this Goto is encountered 
line 5000*s address has to be laboriously 
found Bui j like the line: numbers, its address 
is 2. consent. 

T" seems pointless to spsnd a gresi deal of 
time and eilorl ibr a result thai yott know will 
be :he sane is the list time it was calculated. 
If ihc line number reference m a Goto is ex- 
changed "or its equivalent address then no 
sca-ch.ng is necessary. 1-oand Beho.d, :his is 
exactly wiai my program for ih* 48K Spec- 
trum does. In fact, Gosjb and Next Matemcnt 
are spticdtd up in a *,im.W way, There ore not 
the only commands to divert the execution of 



Figure 1. 

MEvlORY CONTENTS 



WHAT MEMO R> 

CONTENTS 

REPRESENT 



236 



GOTO 



43 



48 



48 



14 



BINARY 
NUMBER 
TO 
FOLLOW 







100 







100 IN FLOATING POINT 
BINARY 



a program: Continue, Run and Return io as 
well but these are a damn sigh harder to 
jpetd up and : in the esses of Run and Con- 
linue, crer: h i much isjcri anyway. 

When writing the program I've attempted 
to abide by the following t«eo aims: 

■ Fas tfr Basic mus: work wit i all Basic prr> 
Q"aiT5 even if they were tyoeeJ in without 
Faster Basic being ir. memory at Ihe :ime, 

■ Fist-?r Basic should be totally user 
tNiriftpRmnt, i fi il should do its job 
without any special got ion Iron you. such, 
as calling machine code, 

The L.2JK of jiiaUuuc iuUc Is sandwiched 
between Kanitop and the use: definable 
Kraphics area. Before ninainc remember .0 
save it, jus! lobe on the »afe side. All the Basic 
dt>c-j ii to poke the machine code in o 
memory; a lasJt that takes a .uupleof miiiulB. 
When it's successfully finished uc machine 
code can be s&ved w.th: 

SWE ,,= AST CODE' CODE 64358,1310 

You can reload at my tine with: 

CL£AR 04007. LOAD CODE 

Initialising the program is a simple Uis-t, 
just tyrJe: 

RAMDMI2E USR 64082 

You'll get a new startup message, infor.nirg 

vi>u ih.u ihc n:jchijiL- uodie is u j jud ju Tilling. 

You'll get the san.e message ifyouuseNew, ii 
replaces th; usual Sinclair copyright mcs>aK*, 
ObviouHb- you don't wajt to have to use 
memory addresses directly in Goto at id Gtisnh 
statemeois but stick with the gmd old system 
of u;ing liae number jt. Th? computer t.iere- 
fore hai the burden of h*?in£ in rriu-me^T 
both the line numbi.r and its corresponding 



%'l fO\JR CONPLTER MAHCH 1985 



Lidtlrcss for eLidi Genu and GosuLi. Beeuust: uf 
the way programs are stored in memory this 
isn't too difficult to organise. When you list a 
program you don't see the whcle storyi parts 
oP the program — as its stored in memory — 
aren't sUowu, mainly bemuse these puns hit 
for internal use by ths computer and look liki 
Cibberish to tnylninii but i computer. On: 
such example of concealed program is ihf sbc 
bytes of data that follow every number used in 
the program. The flrsi of these six byres 
a' ways has th:: valu: 14; a r.mr.bei; which 
signifies to the listing routine thai it shouldn't 
a:tempr to display ths contends of the follow- 
ing five bytes. 

These bytes contain the Unary fbrn o'the 
preceedLng decimal njmxr. Wher. a program 
is run these binary forms save the computer a 
great deal of t .me by being M.c I J use these 
binary forms directly without having to cor* 
vert the decimal rt presentation that ycu typed 
in originally. For instance the statement Got) 
100 is repr:sented in memory as in figure I, 
There's a similar format for a Gosus 
statement. 

Faster Basic replaces :he binary rcpretent- 
atior. of the line numbe: with the address of 
the line. This is perfccly Icgtl as the com- 
puter no longer requires the bir.arj bit as it no 
longer uses the line number directly — it's 
there (or your reference only. Occasionally in 
a progrim you find a Gcto or tlosub with not 
just j line numbe: but a whole expression, it. 
Gosab 2000 + a "TO, so the value of a deter- 
mines which line is jumnied to, In such an in- 
stance Taster basic doesn't alter anything, an J 
when encountered it is treated as notmal. 
This isn't a erea- handicap as statements of 
uis sor. ar; pretty rare anyway. 

Speeding up a Next statement poses much 
irtOTt of a pfOfttem since ihere arc no conve- 
niently placed fire bytes where the address of 
the line car. be dumped and. secondly, it's nor 
envious where the Next must branch to, i.e. 
where;*! the Fur associated With that particular 
Nexi? The way to get around the first diffi- 
cult* is simple — if thtre is no Storage urea 
then make on;. A dummy binary represent- 
ation area is insered just after the nanve t Tthe 
^ariible in th; Next stnemenr as shown in 
figure 2. 

The aiiccnd problem isn't quite as easy to 
snlvf- Clearly it'n necessary tn find 1 lie line 
r. umber of [he Fo: connected with the Nest in 
cuestion. You cotld fmd it by heating the last 
For statement before ihc Next with ilie same 
variable. However, this could prove a slow 
|irnress and nnT lorally reliable. In any casf, 




jiM*^iw^r 



you've always got to mafceallow*ancts for peo- 
ple wlu Jut ivc great |Jcu»uie from wutcluig 
other peoples programs crash, they might be 
evil enough- o write something like: 

10 GO TO 40 
20 NEXT a 

40 FOR a=0 to 100 
50 GO TO 20 

A far safer a I it nut ivc is to not mark the line 
to which the Neat is to jump :o at all initially, 

just fi'l the five iltuagc liy.es with «uicn, The 
first time the Next is used in the program the 
computer will think to its: If "look, that Next 
ha*n T l been marked with the address of the 
line it should jump to, I'd better Ind out whal 
it .5.". Tlie dpt.tju'i; little line, jud th^icloie its 
adirejs can be found by the usual mettioc of 
searching tbrouch the- program — ir. the same 
wry jb a Next would be treated normally. 
Before the [umc to the Itn: is made its addtess 
is artfully not el in ihe fiisi iwuiiFihe Neil's 
five byte store, alony; with the statement 
number within that line. Th;- futi owing time 
the Next is used no searching is accessary — 
the address of the Fnr line is ahcacy hicre. 

One pioblem will diis is Lhai ;.>. program's 
length in:reases by six bytes for eve-y Next in 
ths progryrr. This, aionj ^ith tlu fact the 
Faster Bisic machine cchIc bas already con^ 
sumed over IK abeve Xantop, means that if a 
program was crammed into th; Spectrum's 
memory l:> War w.lh ihen, diancei- arc, afler 
Fester Basic hai be;n at it, it won't ."it at all — 
wtllj you can't win them ill. If this is the case 
then you'll get an 'Gut of Memory' report 
when yoa try tc run the program. Fe warned. 



once a program's been 'compiled' it'll never 
run again without Faster Basic in memory. 
The m&ial of the story? Always keep i. copy of 
die pre-com piled veision. 

\*heo uiing the Faster Basic you'll sftin 
find yourself with a litook screen while a pr>- 
Blum's being nompiltd, eh her if y«u Run h *r 
u*y and use Gorti — be patient the program 
hasn't crashed. A Bi$k program is rc- 
corcpiled every tine it's re-entered after 
rou'ye modified it in any way — and " include 
loading or mergir-p in ar.othcr program in that 

— even from Microdriv*, Auiorun is handJed 

— loading an autorun program will result in a 
ihort delay while :he prognm's compikd 
before it bUTSIS btO action. 

]l:c<insc of the miachicvioiu w.iy ilie 
shadow Rom in Interface 1 operates every 
time an Interface 1 'Microdrive command is 
used Faster .Jasic :s fbrc^d ina:li\e. Alt^i 
such a command use Randomise USR 64061 , 

Vuu'.l £el lllC &tiii L uic^iRiigt: |jiiiUci up 

again but ihe program in memory is preserv- 
ed, rjnhrtunifely this method can tirly be cu- 
ed wiih Icterface 1 statements used as direct 
command*, its not possible to use these com- 

iiLLJtids ijj liii atlLal JiLjji Jiil d! all. 

It's difficult to give even i rough estimiteof 
the speed increase gainec by usin^ Faster 
Basic. A program 30K nr so in length cm be 
considerably improved speed wi^c especially 

:f n wa'sn'L wr.Ut:i will, ihe musi ..peed 
dependant parts at the start. 'Jhe most impor- 
tant factor is, of course, tile a:uuuni oi nines 
Nests, Gotos, and Gosubs are used ir. the pro- 
gram; aul I think jouTl sgree that they are 
well used commands. 



s-igure2. 

HE WOFtY CONTENTS 



WHftTMEMORV 

CONTENTS 

REPRESEMT 



243 97 14 



NEXT 



Fh/E 

STORAGE 
B V TES TO 
FOLLOW 



FIVE BYTES TO STORE 
ADDRES3 0FUNE 



10 
20 

30 

40 

50 

60 

70 

8(0 

90 
100 
THEN 
110 
120 



FASTER BASIC 



4BK Persian 
RiLliriir d Taylor 



REN 
REM 
REM 

REM By 

REM 

CLEAR 64057 
LET a= 64058 
F-UK i=0 TD 20 
LET t=0: READ v , a* 
IF LEN a$/^>lNl (LEM a$/2] 
GO TO 500 



) 



"A") 



48-7* fa* 



1-30 LET y=CUDfc. a*tC+lJ 
(c+1) >= II A") 
140 POKE a,16*K+y 

LET t=t+16*K*+-y 

LET a=a+l 

NEXT c 

IF vOt THEM GO TO 500 

NEXT 1 

PRINT "Data OK - Now SAVE" 

STOP 



FDR e-1 IU 
LET x=CDDE 



LhIM a* biltP 2 
a*<c)-4B-7*<a*(c 



150 
160 
170 
180 
190 
200 
210 



(listing continued en next page) 



YOUR COM PUT EH . MARCH 1 935 33 



(listing sofllinjed from previous pag?) 

500 PRINT " ERROR in line '"iBBao 
+ 1*10 

519 STOP 
B000 DATA 79:^*,"0000003E0I323AFA 
CD6B0DAFED7B3D5CE1FDCB019EC3FBFA 
F3En4RB45CE&5B3G5C2A7B5CD93E07D3 
FE3E3FED472AB25C5D543£»002BBC20FA 
D9ED43B4SCED5^38 M 

0010 DATA 5419 T "5C227B5CD9ED53B2 
5C2 1003C22365CEE363E2BF92B2E223D 
5C21B65C224F5C11AF15011500EBEDB0 
EB2B22575C2322S35C224B3C36302322 
595C360D2336B023 " 

0020 DATA &193, ,, 22615C22635C2263 
5C3E38328D5C328F5C324B5C2 1230522 
095CFD35C6FD33CA2 1 C6 1 5 1 1 J 03C0 1 0E 
00EDB0FDCB01CECDDF0EFD363102FBCD 
6B0DAF323AFA1 104" 

8030 DATA 5325,"FBCD0A0GFDCB02EE' 
1 8488027*64 1 535445*220424 1 534943 
27204F5045524 1 54494E472053595354 
454O20427920526V636B6 i 7264205461 
79£»C6F7220202041 " 

B040 DATA 7042, "75677573742C-3 139 
383 4A0FD363 102CD95 L 7CDB0 1 6AFCD0 1 
1 6UU2U0FCD I 7 1 BFDCB007E200C2 A595C 
CDA71 1FD3600FF1SE42A595G225D5CCD 
FB1978B1C237FCDF" 

B050 DATA 7997/ , FEDD28G7FDCB3046 
C4AF0DCD6E0D3E 1 9FD964F328C5CFDCB 
1 FEFD3600FFFD360A0 1 CD93FC76FBCB 
1 AEFDCB304EC4CD0E3A3ASC3CF52 1 00 
00FD7537FD 752622 " 

S060 DATA fo448,"0B5C210i0022165C 
CDB016FDCB37AECD6E0DFDCB02EEF147 
FE0A3802C607CDEF 153E20D778 119113 
CD0A0CAF 1 136 1 5CD0A0CED4B455CCD1 B 
1 A3E3AD7FD4E0D06 " 

S070 DATA 6172 1 B 00CD1E1ACD97103A 
3A5C3C281DFE092B04FE152003FD340D 
01 0300 1 1 705C2 1 445nFDr-B0A7E2S0 1 09 
EDB8FD360AFFFDCB019EC34FFB3E1001 
0000C3AFFBED4349" 

8080 DATA 6794,"5C2A5D5CEB212FFC 
F57AA1fif;37ED52E56069CD6El9200BCD 
B8 1 9CDE8 193E0 1323AFAC 1 7<?3DB02B2D 
C5030303032BEE5B535CD5CD55 1 63E0 1 
323AFAE122535CC1 " 

8090 DATA 7443, "C51 32A615C2B2BED 
B82A495CEBC 1 702B7 1 2B732B72F 1 C345 
FB2 1 FEFF22 4 55C2 A6 1 5C2DED5DS75C1 B 
3A445CC357FDE7CDBF16FD340DDF0600 
FE0D2E7AFE3 A20EE " 

8100 DATA 10477. ,, 21F7FCE54FE779F 
DCB0C7E200FrCECCA97FDFEEDCAA8FDF 

EF3CAE9FDFEEA2B55FEFACAB1 FDFED52 
Q0ArCC6CA52F AFEEFC244 1B4F3E0I 323 




AFA79C344 1 BCD54 IF" 

8110 DATA 7869, "D27BIBrDCB0A7£20 

7 IFDCB097E20SA3A3AFAA7C477FE2A42 

5CCD6E193A445C2B2AA7C2EC1B477EE6 

C07B281FED7B3D5CFD3600FFC9C1FDCE 

0C7E20073A3AF A A7 " 

8120 DATA 72B1, 1J C477FE2A555C3EC0 

A6C0AFFE0 1 CE0056235EED33455C23t>t 

2356EB 1 92322555CEB225D5C57 1 E00FD 

360AFr 1 5FD720DCAABFC 1 4CDSB1 92B02 

CF 1 6DFFE0D28B7FE " 

8130 DATA 710G,"3ACAA8FCC3eAlCCD 

82 1CDFFECBC28A 1 EC 1 EF0238EBCDE934 

389CC3ABhLt:uC2FD3047ED535D5C5E23 

5fa234EC33AFFDlFD660D24E333ED4B45 

5UU3L5ED733D5CD5 n 

8140 DATA 6333,"011400CD051F1BD5 

2A5D5C7E23FE0E2B07CD1B2D30F5B7C9 

EB21 05001 97EFE0D2804FE3A20F0EB37 

C9CD821CC3671E2A5D5C237EFE0E20FA 

223BFA35CD6C1C01 * 

SI 50 DATA 6142,"06002A3BFA340922 

5D5CFDCB374EC22E1C2A4D5CCB7FRADR 

1D2322685CEFE0E20FC0023S[:DDA1DDB 

2A3BFA23E523237E235F?3SA7At85C01 

0F00094F7EBE20 1 A" 

8160 DATA 745R 7 "237ABE2B20 142323 

79BE28067EEIE5232377E15E23S64FC3 

3AFF5E235An52^7EEBF5CD6E19FlED4B 

535CB7ED42EBC 1 E 1 73237223772371 23 

7P4FH33AFF2A535C" 

3170 DATA 7954 1 "2B11F300CDAEFE3S 

0ECD03FF2A5D5C 1 BF0 1 1 EC0037F52 A53 

5C2BD5CDAEFE3B09CDD0FED 1 2A5D5C 1 8 

F1D113F13F30E6AF323AFAC97EFE3A2D 

1 5237EE6C037C023" 

8180, DATA 74 1£V23223BFA4E234£,C5 

09444DE 1 1 600C5CD8B1 9C 1 D0 1 8E3E7CD 

C2FD3806110Q02C3BB19D^CD3B2D2A3D 

5C23E5CD99 1 E6960CD6E 1 9ED4B535CB7 

ED42EBE 1 73237223 " 

8190 DATA 5313,"3601232323225D5C 

C9E7237EFE0D2B0BFE0E2320FE3A20F2 

2B0I0600CD55162323E52A3SFA5E2356 

010600EB09EB722B73EI36BE0603^336 

0010FB23225D5CC9" 

8200 DATA 33B5,"2A535C19CD541F38 

0C56235EED53425CFD7 1 ACF 1 4D 1 3EC0 

A6C079C345FU" ■ 



94 YOUR C0MPU1FR. MARC-I 1985 



New-the official Spectrum Upgrade! 

Turn your Spectrum into 
a Spectrum + for just £20 





■till 


f*" 










*B w JK K ™ -. 


■■> 




h 


V 


L| Tr* . .#ll 


sis* 

11 


Mil 

M 



• Professional M-siie keybearc 
- indLdef 17 extra key:. 

• Responsive typewriter-s^yle act on, 

• Accepts a I current Spectrum 
software and peripherals. 

• Complete With fiLVpagt 
Lser Guide and Companion 

Cassette. 



I lcr« scrne exciting news r>t 43K 
Spec-run owners., the official 
Specrrun Upgrade <it 

The 120 Kit has 2veythtigyoL 
n^ed lo lurn your Spectrum into 
the sty%T new Spectrum + Ycu 
don't even necc an undefslarvdirig 
o electronic;, jifil the a >i!iiy to 
solder a few vw«s togelheri The 
leaflet in the kit gives dear, >tep by 
itep instructions. 

If you're not hji e about duiujj il 
yourself, dor't worry. 5 i in ply return 
your 48K Spectrum lo Sine air and 
fa £ SO we (1 upgratc it tor you . 

Whiciev^ryDudedde on. you'll 
also reee ve the iew 80-page User 
Guide a r d Companion Cassette. 

Tie Digger better SpedruTi 
keyboard 

The Spectrum ■+ measures 12 Vi" x 
6' It has i liiffje typewriter-style 
keyboard, w th hare, moulded keys. 
You'll fine the new keyboard has 

a :rti(x>th r posttwc action ideal fc 
ttucl -typing, word ztrocesrting, 
simulation programs, and extended 

I I ii II •, i . v 1 1 1 ■ 1 1 1 -- iftyu ly T WO retrac- 
table lcjE*giv? a Mffccttyphg 
position. 

There are 59 keys in all. incUd- 
ing17 new teys. Program rrcrs will 
be pleased to we dedicated 
punctuation keys, a space bar. i nd 
separate ihifl keys for graphics yid 
«*tendec modes. And a rusct 
button alow> ycu to clear z 
program from your computers 
n«mjiy without dlstomecttng the 
power supply 

The official Spectrum Upgrade 

Naturally your U3gi*ded computer 
wll accept al the peripherals in 
yourSindaii-5y5tEm-lnt;ifi*.c 1, 
Mfcrcdrives and so on - as well as all 





SjMJi.uiiiribolwafc. 

Just as importanl. new Spectrum 
software anc peipheraswll b? 
designed with the Specif um + in 
mind So the Smtlair upgrade adds 
Styiish looks, new capahiliti« and 
new potential for \h? future, 

frducJed -the new Spectrum + 

User Guide ard Conptnion 

Cassette 

TherewUserGjide 

his O/er 30 pages of 

information, incljdmg 

ahandyOASICc.il.- 

tionary Tie Companion 

Cassette provides an 

■nteracUve tcur ol tire 

new keyboard, and irtdudes 

lhr« entertaining arcade gsmis 

TO ORDER BY MAIL: 
When ordering the Upgrade 
service, send oft your 48K 
Spsdium to the address, below. 
carefully wrapped, together wit i 
the cempieted coupon and appro- 
prate payment. (Please do mt 
reluiri the mains adapter; manual 
orothcrancilarieS'.) Ybu r upgraded 
com puter wi II be despatched to you 
wi.i iii 1 10 days ufiecevtngyojr order 

When ordering the Upgrade Kit 
Simply com pletc the <rw j pnn, rnHrw- 
ing th-: appropriate paymert and 
pest il to usatthe acdress below 
PteoMjallew ip to 38 day* fqrdel very 

BY PHONEt Access or Bardaycard 
hrtde's can callQrrberlcy J027& 

6E5311 for personal al lenti o n, 9a rr 
to 5 pm Monday to Friday. Only 
th* I ipBT'-rip <ik car: be ordered by 
phone 

fife a je note; fie upgrade offer 

ap pffes to wrjktr>}> 4SK ipeanum 
models in the IM onfy 






inverse 
True vdec video Cmphlo 



Edit dps locS> 



Dete'e 

rrode ' 
CjfS slifl 
5em colon- 



> ^^Cj-f^TJ^ 



ireak 




I nverted ■omma Cwwt 'omralf 



Cw-Turij 



I To ; Si n cidi r Rcwar ch Limited. U pgj a d i DepE. r Stan l ope Road, Cam bell eje 

I Surrey, 0^5 3*5. 

J All p*K« iridu-ck VfiK post aid EacKin^. User Cube and Conrfwrton Cassette 

i Pfr*,as««rij mi' IhcSpxIrum Upgrade Kt, I «ncl«cpdyment of £20. 

II Please upgrddt my 4BK 5p?ctn»m tor n». I »nd kc Tiy cormuUr together 
J I — I wth payrr-enl rrf / 10 

| len3o«adieqje.'pCKijior(]er 

■ payable to 5ind4ktes«rchtJmled tor f 



I Plp;se charge my Acccfs/Barclaycarc no. 

1 1 I I I I I LLL 



I I I I I I 



I SigratUK 

I Nane:Mr/MiVWVs_ 

I 



rUEASCWtNT 



Adcrcss. 



VOGS03 



Sino'.i r ftewprrh t fmif M, 
Unmade Depaitmerrf, 
Stanhope Road, Carnbe'ley 
SLrrcyGUISJPS, 




TRSOFTfc 



A reminder of how to use the Telsoft service. 



TifE PROGRAMS given here will e liable 
Sput:trum and BBC owners 10 download via 
Ytur Cotnputerh Tdsofi service, First type 
the hcxhjdir fur ypUT machine — fipure 1 - 
and then en:er the machine code — figure 2. 
O.i the BBC you call the service by entering 

CALL A6AO0 
while Spectrum owneis muse iyx. 
RANDOMIZE USH 60000 
So far OR Ud'i lekmoci 2 and VTX 5000 



modems have been, tested with ihe service, but 
it also vwwki with a ciumber of other makes. 

To find out what is available on Telsoit and 
ilovJ if rct'eWe, suflwale dial up ColcitfStif 
{0206) 3068, This audio recorced information 
J0C will also advise you which telephone 
lunhm co Vtiig for the 300 and 1200 bil/s 
services. 

When n program you want to download is 
jva.lablt, mate surey wf modem .4 Kt ut and 
dial itu nurnlxr appropriate to your :iiodeiv.'s 



sceec. As soon as you hear he modtri tones 
twitch the uiogW.i ti line and r^plicr rhi 
receiver. Select Option 1 from (he rrenu — 
Rsce.ve. After i block of dati is received, you 
will set: "OK" printed il'ihere were no errors. 
otherwise the program will wait for t lie block: 

laconic round igilin. 

When the "Program loaded OK" nessagt 
appears el urn to ihe Telsofi menu and select 
Option 5. You can nou' save in J run the 

program. 



Figure 1. BBC 



ce 



J 'UN 



10 RES BBC HF! CCOC LQATER 

IS HIIiEn-U^Ff 

JIB LI ij: PRINT 

3B 1WU1 - HT,M=:T flCHJUESS (HrH>"ifl 

4a A-ffVAL fl h »a*j 

SB If *>L^TP7 THEN 2H 

CE IF w ii,M»» LIK H^JLJiht * I I1LN .U 



■■tJ IF \.mW*\ OJ.4. THEM Sfl 
L 111 FOR h>m TO 7 

i ;n Xfj- fID*(E**,2*«'l,ln EUStK IN 

l_'B If F«l THFH ZM 

MB XF- rlB-ll.B* r 2«M*2.1h : Haste 3W 

tra IF E-l THEN 2faB 



j ue b- e vn_ i ■■ t - -mi ut i b> , j«p a , a i 

i™ ^fl»H)fl-fl»l[T-r*B 
1LM FJHr 

1TO FLAP. F1 - I TD -EN (C*i 
7» (tMllunn ,M, i i ; 0D3(_n 5«! 
71 B IF F =1 Tt*FFJ 1*0-11 finffl 7CS 
234 NEt I 

73B [F T- = VF¥.l ,, fc u -lC*> iHtM 3B 
24a KMJtIP "l_h»L.K!>^» LKIAJK 



7MI PfllfJT "UPlt* EfflOR '" 

371 Arg. (A D1W Hmnn 5B 

7(10 fCALT -DCW*-0AB- fantiB tf-97 

79R FWT1 

'UP F^*!|F f»r'»H..m THFN F>l HFTIAH 

JIB IF OBCUUIfM Tf€N MTLF.N 

lif. IF fl5t<IJl<A5 ThEN E-liFfETUBtN 

Jl« IF ASL'llfl/'. 11-fcH £-1 



Figure 2. BBC 



&mn 5 fl9t:BflaF-TH3in"jBi-Ji , ;i t 
6HB c^FS041AC2fl46AIK7? l 3ttA 

.-..ft 8 t3 1 FBERr7f3 n f at 9 :y , ir.B 

hfli h i i^f aeti iLau»^ « c v 7 . :es 
tiAm iQHHavi jar4Fr5i,<r[> 

i.'s'^ ;UjnjeB7*F4FKAW»7, :A7. 

-■Aasi « riOaP7eiF4FF*iUV'J, 1HL 

6^1 tr ■ UL^It .v+ ^UF ;' tBW . J "V? 

fiU'l" :I1*,:«1 ;WF*FFPilTi!, '!-H 

(...^U (i.'JH HHVJHVJ LiJ T'.'n.' 

^T.k» ift^J J S^-rSIl ?BF flFF JU . iU.1 

<fA!iB 1 Bli iL'JUF H ^WH_fat;tll» , 34 D 

a(iy» lF-HAIHBF147 7a47(1^4,<l{i 

4*79 5?' , »l317flE47DBE7(KB,;BP 
b4da ■m6G«^VH",wiat:<?=iB<ilr'J 

^.IWO :IJflT^71Wr:j;.CB«IKP l », 'ftB 

UWI !■!«!>: -a, i' i;s„ni a>^. .t-i 

WWO 3 DBFeftBBM5'*2 , 'flB.i?7 

iiuia tP M JH fi iCSBTj.taafl ,ssn 

/.MHh1 . I 1*^. T." M 'if * 'WMI.hL., .'H 1 * 

ibAfift tHB2aC3FFEa2H5,U4 

tABB ;*iMfl1iKBFSIftTi71IH T 4 33 

(.ALU >lStt39Me*CMMC3, SCC 

MCHB iJIBf-nriLb 'ffl20HC,"4r 
hflPfl :SCr»HCC37BFBWH(lV.«UL 

£if*.n 3B2SC3FI iTJL^l riC v 'AF 

H.ffn h7fjAr\<7.Am l W:YiF 1 ,<.S£ 

bfFd iUeK2K7FFA9«8CII,;Be 

W5FO :E3F-4CI36i"CA7(ifl,'l!.V 

t,uea i'n)BatH'J*u4.'U£0BC. x:'? 



bUUB ! fcZBBF 7 ■? I T &7KKWB , 47T 

HtUt ;C:C4;5D«f )2a*t6t.4 5.l 

frEJLB . IMC Ji.-Jfkf IHin^^TIB ,4f 

f.nn iTflFTTFwrTFr^Cii?.*^ 

frtl^B Ih.K'IBVtJtJItBtFCTiTl.-'.ri 

i,Bl» :F(l(5F>i:'?5a;Hf3FT4[,44r 

ftFL^R " ^./ A*fc\ B1I • r^DVPF- ^Fl .4"?-^ 

&B4B i ft"i77u:rA'?n»9'iri56r , ir(, 

*h4r ^seM^BawatEflDT^u 

t-Uilt I t J A'rt UilUiSiCfl^Sri . ■ El 1 

A.FWB I 203M eFVWBl:(ft.b6t ,i'fj 

b94> I ft? J 3f2017BF<4FF ?»,;■?). 

KBJ,B !F'<iBf47|CE«fleP5BS 1 5lfi 

t-UVlf ilil UHtrrfUIHF '.VJUJL.401 

ftH-'B I ,'«F 'J F Vfl*^JitBO^A . 4 7. T 

' Bt)0 i05Dm"7iJ-|SEai-rf7B^,;i5T 

eHHU !MHB*e™FBAiI7afiR. .m 

h.B'?* : hi A'J*52««M,Efl'?l3» , 2[M 

tUVB :.:V1F "<-F-.-SFB*l>W|?7,Tfl,- 

6BAi :Z«EBFF4CBCtW5S.3iF 

iLU'ik . ^ J : Bd t ami 7»^6C . 7 Di 

n nPD = 4r^j5J nfl.4 T FV7, BBCifcC , SDi; 

>hhi: :►■ h mv «.-a<ir 'if ■.■amr. -. . 



?-hi f 

(-1H.L- 



' 

ihF" 
ft[iFD 
iLIM 

ftr.wi 
t-i. in 
id* 



iSC4C 1 Qiyir:^rf:00? .s^i 
JVjm !FFA>Ji,rzaE3,4 3D 
r- A>?4|) vJOL JF F iUA» T 5 1 = 
'Vr'H'G l'J'F.l»i8iaApi5FPn7[H),4 tl 
UFt* :BRA213iaf+FFVl2]J,Sfl7 

i ^Cl- 4h I- fltfl^J".!' fillflK F > ^l.fl 

iF-ft7"f,7(B-4i i(,anv,^^.' 
s ulnadBOABflFPa?™, * i " 
rF-^i7r.-7Br.irrrt?52,*E7 

r '--^r 4t FAHlMAWiMI , A4~ 
lH-H4HFB 1 fl|ft308Za,ja» 
tFqFFWMItBBTDBBri, *4=F 
l4,ityiiLHi:.Aft47EZB,7Dt 



ftC^R ;4<?ftCFfcR r iM»73ilft[J,374 

CiCJB ift.20«*B2DMiM?V,!ei¥ 

4£11i iiMF)|ML Iph^wi. LllJill , 1.1.' 

hC4B sZarfFFWHi'LtnaH ,5iuL 

I • '\- n nii«;7r.TiiifHrAen .rvui 

&C3B =rOrtF.d0fl!HIK^ -IftU.tsti 
N.1B :^H4 c 'Jb[:RnCBFA*47E .449 
6C«B i Iie'VtUfFiWI&r ^f f i-H , Q2 

MtnH : f 4FFC?BBasr Acnar . * ji 
bCB i2aL^FiJ.'^(i:riwo*. '4-1 
w: T F) = jBauyiE atsi?f'H Z* 1 ; . 2Fa 

HJIf E W US*' JfWBC .Bl U.L.LI , j't 
&CRS :7fll lAnr.F4ITBBRr. 1 ? ."TTB 

bCB ifl2F»llC?43f0l74C,3lV2 

fciJ'B !di4:AVaiA7f| 7FJIF4 . T1T1 

H.'-iu -r.- jr tj't^i'Ji'uftJJUl . JL4 

&Lab i?hf n- - F<i:R7drfl l mn .43- 

H.*IS ;A7UH7BFlFFtt,M*5.4CE 

f.rhP :7EI'eE;i 04:t^-M*t,4i.tl 

6CCB lHlllfl'»H7iWIBdr7flFR.7r* 

J-.F.CB :&DftB]-rjl5tDL'J1] ..t-il 

lil 0B i F-aUM- VI H- B I I C 943 . 4 1 3 

6C*D !^i»l'4C(;.|^ J C-t^JB7*2,.'..• , : , 

fcCFB ■1U;-'ITF'1F -lL^VtU»9,"i7F 
,'f l-r*CF19.*M 

WTFB !dtiflifa7r*2B*:0r <r> , 

;-ll O 1 L4U»tri^ WiC'rTI ,'U JWV , 44 i 
ftllftB [&9FFWBBHA7J17HF*, "f -3 
CUB iF*1^/'_-jat3<rFZ«33.. IT'j 

fti'io i4C21rHfaCft»aH*»M>, jei 

:* < ?ci?.?iacw,rjBrii,;,LF,ici 

H' -k ! i •jintt LinwB? .'flBa^F . 774 

OPJB s-flFtti[JEIinEllCFl9a5.:ft,D 

t>U!-B : .ai3Eif.iW-B4DraAB ,10* 

oofu itoatTfcWMijtu itf ,aw 

ttUB :(!9i1iT7SIFFFra-i7K3f,B.4tlB 



fb*o :ft r .uc2«:3.rFrfl*nt.n,7£F 

17 -Sfl FA9n77MBhtr>9*nai,3Bl; 

*rEa iD^^ciiG^ninazt,^! 

IDftO !FEH»n7FMatD'i'B<"J(.LI, SC9 

(U'jU ■■ i.'uwAUJia l r9<iC»8AB,^t7 

bd.'Q !Brn.9a.i7a?ai.t:aFti,;Ct 

SD7R 1 iit?B*3fc Df a7:aaw.??» 

onHR : F IF F"9E-7 IrBtHf H B. Sftt 

frDIB =ASBFfl7Ba7("F4FFftH.1K 

-.u"y i t^fl'™<ji:u«Btit7* U, i.9'i 

iDAI : F>0i'B«tl(.D»Bi««M.H 1 Ji* 

M.CWt I»fttM0Z*7tTae?,*« 

ftDRF : FFftBiBTTFBbflcAiP.SFC 

bDHt i4M!VlBC?;rtMe3IF. IF 

«DCEi . infl. T l^t IFF LU/Uflt , J 1 J 

bULt 1 ■*3M0»3AiMi3l Uft 1 ;, ifb 

!il)rw -_H77BF7iFFAa4TlTBar,ii^[ 

bCut ii r *^2aM&;B2n^BK,3Bi> 

bCEf =Ar.7R49flRnri7BJlifF H 2 ( 'l) 

jLiLL r»'- , lMy&. r A7t/A2i!|7F,2^9 

'TiF* :i.3AmFFViB7aF3 e rei>,9AC 

bDFE IB Fi^ijVuliWSFtirOtf.iF- 

bEBE :Hb;iHM'JSi'll;it>,»'U 

L4.BL' !l.Hl7K»«FFft ■IHjP.-'h'I ,Mjf 

'*ir :nnBFWB*7flf4-FtTr t *F(i 

i£lC sBlFBKFVJTCWHBP.aCJ 

blZI) : h L fVfky aOMJ V»UF V . Aft . 

\-r 7n . c* y r , x77r^*7'ft^*OAi>, ?d. 

bCAt ■ BIS I L fli/ 0*471199), 4 4« 

i«5JB =A?a!7HF4FF#9BMI.4B' 

LL4W ie'2W4l"l »rf6*,20R.4n3 

FJ^4H ! 7FjT4FT9R-"fB7=OF'- 1 4BA 

iE5S ifli47Cf«P?'7*2PJ97jBF'.41F 

fr^pj 1 FFCl9 l E3fl2«4aW= 4t>' , «■£,* 

L.Lt,^ ;«Wl(17;a»7S)F4-FTI».4'?F 



MAS :0"E«7B«B5<>B6<4E.M;i 

t* It iH.lf*1^.-LfM.fl>CH Jl, SLt 

Aj:7FI . UIFI7Fft#.7nD9l?iia7 p J4>. 

oi OP BO:P*"4rF*H2»BHFH,5CC 

hi n» : BBfTO6A?¥?7HF IF F . JBH 

(4.'7P. i1fllu4t9>lA»rt<b>JlA*,AM 

ftlF^R ^7FC»444F"S7*F«r4r.7HI 

b*AB ■4l4«4V1t4': 1 B*l)4a,.'Li 

hJ-AB :4Frr>aD3L?B7B2*52.i97, 

(X.DB <M.'t2K'lwnWli,ii.' 

r.Fnn 7fl:n7fflF.34^49*4a 1 inF 

UC( 1 EH J3*4 ;ea^i 1 7 <aS , i£ft 

(HCH :Bnjr.7B?e7B*35B47,lSB 

i-LL'P i»jlTS4<«iTM24:ai.,MD 

nFriRj ■4 9<7-lirH^<F?M4El?,7l7 

ft,rrB , 7p*r;t5 c iirM'M^ , i - WH.<c-*, 

itfcH !7BJB=fr J 5J4^?B47^a, IFr 

AXFB i^74r7TH77B544r2B,(F5 

L-LltJ iy.'1!;MM3;iHT,4,-5t 

««i :4F:B*pd54E553iaff,iEp 

M«J iaLHr<4trt4Jili»3r»l 1 £fl« 

tMtltl !lF-34nJ9Ti47B4:A1 ,7«F 

it]9 i7bt42«2t.l74bS«D,7<72 

ibF^B l41LB7B7B.173Ti7tV4r.llbJ- 

fj"Hi 1 iii > U inn 1 1 mil 1 I k 11 11 

<bf3a r*B?B7«t7*iT , 5>nar...-Bw 

F.F36 :4 7:e3:'2T03-Pi'p47.,F}H 

tii *a 1 o 1 . ^.t 40tra s«i^i inj , ii J 

H%F*n t^7'<FS4 7JR*FK.f^4S7B.7T , 7i 

6F5« r42ii JS*4?a526,74.7C3 

bF SB [ Jj5IWMKi7*F4 f=7' 1 , I lO 

& ftffl i 4ri:«?(t*l ■ 4F4I444*).LF7 

■TAB (44»2BBrc>BBDSeS2,nD 

L-t'fl l43U3hk41MI4l£9*jtllt4 , l.3 

ftf7J? :4n'a>i97n4/j4FS72fl,79B 

tVOB i4D'94E»aa2B»2a,in2 



Figure 1. Spectrum. 

3 HEi CPECTITUhl 48* t. 4 

II RIH Hb. C*j» La4f*f- 
93 CLIiV! bv»«a 

21 ¥W£ 2J43« T B| CLf : PFIFfT 

3* IUFnjT *atirt M4r«> "|« 

54 IF i>lim TI-FW r-fl tn 7FD 

M IF nOdH T«r« DO TO 21 
7» K«wr m 



BB LF>"UI " I "I hi 

IM, |l g*-*BO" TFTN JiO TH ,BB 

9i if i en u*;ti* lHtM 50 TC 2iiB 
tan Lti v-«-/j*«iNi .-jjj.1 
ilB Hl-i n-ii u J 
1 7Ft I FT nJ»htf7«r»l "0 2*n*ll 
125 EC BUI IB* I LET "-■ 
I Hfi FF HI IHrw r*l T»l -i'« 

1*B LET iF-h»[7Fr»S TD 2*n-r:i 
149 BE SUI A«*t LET «-y*lA<> 



fSB IF —I TltFtl BO TO 768 

|7B l-r>;L *,Vi LEI i-B-1 

L»B LET t-liyj NEJC" rii LEI v-t 

;9B FOR m- I TH 3 

?M1 El FB-h*(l7*« TO 17+*) 

IBS 30 fUB WB: LEI V-/*1B*M 

."IS IF b-I I4.N LET *-»-ll QO Ttt «m 

22B NF.ST m 

738 IF trry 



74* PRINT 'ChBEliiuti Eifo 
2SB LET a- j X BO TO SB 



■ iwi <j/B) i f» TO 



HEX miHT ■|"ll»ii « 10 M 



.-to i'F'J«i 

77ffl I FT • 

231} BflM£ "dannleae'CnDE IbaBBU , 1 I St, 

7VB POFX: 2U2B,ll S'tJl' 

Afl* LEI B-4II LIT P-COJE **-4fl'7»lK*>-+" 
JtlB IF , 'PI OR . >ir TUFN I "T M-i 

32B HETURN 



Figure 2. Spoctiurr,, 



bBoaa 
<,pwas 
amia 
^.eB:4 

:■*?■■' 
ftPIB'fl 

4av4a 
.-o.i'-ft 

J.BBii 
.»'(!■■ 

...l.'f:... 

tae^t, 

ABIB4 

fa«t .2 

...I; -i, 
■I (II ?R 
(.»!!.*■ 

dan* 

nnjr 
fatllfcU 
t*l*0 
faBI'i 

'.mil 

faaiT? 
faBSH 



^UlSLLFLjaaSJL.LH3 

=; n. vueaiauctiztt 

■ ZMB I'll O-* ■•(•r rjir-n- n 
iBBEDFEAICrt^F'A^F 
I 3-5CfiS7E c 'C3»iE fl^D 
ll3ED3F.Fsn:i)i*EP;D 

■ 1 !LI,lit.Vl.UlSLLKJjLJ. 

;Liujt'i£.LI>l lEfJf.tai. 
I8B3EFFIZ13 BFr-F' 
i i5EtlirSeFUftif<F, 

i2ai:iAiaFc:r:DiFED 

lABFdCDMCOCDIFEC 
1 7BF !72fa5fF JEBa32 
ifaCEl •■X6FEFIZ?BEF- 
: :.uh'..n-i i:t Hh ■ •■'■'i"' 

i.i i 6* ai tua.'awdL 
iB*t I ABFTFCD . rxw) A 

.^rtF.Ll '. iSr.TlFEFTfln 
i 2BF 3 3fib*EF t BBK B 

< ai*4."a-J*v(itiLFB>; bia 
tllCKLCXIFEDABVA 

si JlJBU.1)LUEC7'«L 

« 1 »2"T O JfliOf F <" nil. 
I Ffj;ii 1 FFtrtJ A MCA7 1 
1^,1 l« PI .Ml '.'I -,-ll I 





fa!2l«i 




liiBWf 


,iLf 


faIZS.2 


,431 


fae2«e 


.-.cr 


MJ*" 


,t9tn 


faKi'iJ. 


,SDB 


faf2&4 


.3FH' 


fa!773 


I.W3 


ftCSOB 


.HOC 


faETSS 


.--,11 


4«!y!9 , fa 


,ior 


faSAB* 


, :on 


»;ii' 


, WB 


d*32B 


,*•> 


6*329 


,14* 


f*Mf. 


,M1 


A*S44 


,027 


6*352 


,»1 


t%Pif>B 


,M! 


t*:.4H 


T 91A 


4PJ7fc 


,»C 


1"^ "ifrl*4 


. !»'• 


fa»W.' 


.<'F 


6»«aa 


,*bL 


AD<»1 


,447 


fa>4lfa 


,174 


fa«4£4 


, 3 2A 


M4Hta 



;LaLLl?b33EB»J:2CD,34|l faB41* 

i PTFr.r rhV,ET.r 3*AFfl , fafi . faB4tB 

■ CXllFEIMMMCAllTB^la t.aiv^f 
iErBE7iEl2Jf5CE3n, , 524 fa44hD 
i bOEFB5bF3E BOBC67 , 3CC faB4 7 ? 

1 ^HWHc AMfl-LTU 'bL, fUh ClU4UB 

i3£2132aaaBC3FFEB,4fl2 h„ijhi; 

:.3L-i»J2lH r ET32'BEF 1 3<3 T faafaVfa 

■I i-H- il i ;* V>lf nil ,*ai (JJSB4 

rElI![lAAA[:A=373JirCi:,lr3l v,nr,17 

iEB£C3A6BILFFEH2( n 'SB« eASMl 

!B=3**¥t"FEtlBBlfl77,433 iASfffift 

1 bl 1 J I MBL MfaAts- H<j, !F[ (.-ilX-fc 

I 2PEHJLJ1I LUUfMnLF . I>UU F,BTM4 

i 2 1 t>FErEiEC22C£RCr , -WW fair*7 

j lFFRn*AAF*i7 I'flFF, TiS.? (^bV 

iFP.*faF. , H'l::,3*H' KJISrMJ 

itF.AEB.^32E3EE3C(N % 4SF« hUlr,7h 

f3:E*1:E3A[H3CFEZL t 3B, 118*33* 

i ZFB3tJJ SEfCOBTei , 331 F,H?J77 

■ ..lAbL: J 'lbT J Lb'J>t,t . N.1 buaisvi 
;L>UT.t.-. ALlHUti..' Ad .42? (AVJ9U 
L«t/,1 fSttl-LMJIfifH-.F .^ftl frtlf.lf, 
iW7FF'=<MH'2RBEA2: I 4Fi: t>Ofa24 
iBT2BF»3EFfM:D34EC.5EH falAfaA? 

: SIBlDTFETCa'UbfcrACC.SB'B FiBaUB 

, I ""[ID JW fii'-U DC IM ;.»>.■*■ kU44l* 

sBtajA^BjFFierBJE.SBfJ faBiflF 

liHOAF-iliFFlJiFFJI-^ftih ^-fl/(.« 



3lDJFr:E8FSZBF5C 

u r uijhi..v4aiie3eBi 

D3TE219|50CB9tFB 

r:iiaBHjf.v,>*Arnir. 
EECDbfaEt>»air>AFE 

i" 1 BMLfc ItUMJUbJF tL 

CPB*ECCl>fL3EC£PA* 
b L^ittj : /I a:p ? Tt'c 

LtJiHSt.LLtAHtLI.llAA. 
rr_7^7J^Bt>ClDFCCCIi 
B4 FT 7 3FD*l7FT.3rH3 
CDHF HXtW* f.f!*f:D 
A3EC3EB7CDBF ECCD 
FmFr7.TF9i7FFr(KH-n 
t:t)l:BivrJ7if:^4ECFE 
bbcbf s it zujDtmb u 

Fl?K39rCCt:i>fi*EC, 

nn«Fr.rn4WFr3fBip 
cdee* n :.F.f f.iTetar: 
r;9TT;i3Eiii ; 8CBiFeB 

lF|-FHPITBIFFfa3*FF 
?.(>! I4.<L.LLL<»/I.'i;i i 

I- I t t rim I- fm.'Mf- tl J**" H 

D4Frt:faa7l?lSrr>a 

CnE€E5CDB«ECE:Ofa 
I ^r«=7B-'T731BFC3E 

BBlFrMHTI >IBLt ^F- 
■' VL5«LtJU.'lFVLUl / 
3B»n7EEEBt7734faF 



na 

,sfab 
,—r 

,14-J 1 

,654 
riPF 
bfai 
*ci 

,*90 

hfln 

,S*i 

3 7a 

631 

37B 
,trUU 

,3A6 

374 

.68C 

4CF 
,*MU 

ft-Ht. 
,4faT 

,*.«: 

,33"J 
.'-■■' I. 
,»4'9 



Ufa7I 

f*ftHCI 
UMiBU 
(aBfaVo 
'^784 
W'l* 
.^' Jl 

*1H.T^|A 

U* 'LB 
«7t>J 
«I77ii 
Bfl 'I I 

■T-r 

V MfB 

BUM 

iiftfJi* 
^pr?7. 

£V'- J IF 
F0F11B 
WW-.*, 

AHBV? 
f*lOO» 

■TWM 
i*W?b 



s E r EE 1 B3BbFEF3721 

; fa- F- F t bl L lb77L'l 1 bUU 

: ."Jl .'I Lfc.lL " I mtBI 

■ /u-.iF>p<:i*5a;r;vjr 

: 9!. 3? n 7FFT r>»TF nCrt 
:rrri)rirw6l!*cllM; 
rFh 't-bF.l>U'bB:DAFE 
uT21'7EF302M237 
[ CTCTD' ,'F IV.HF B*: 1 *!!* 

■ *.'t»B£llICMri#C»JTa> 
:FbVjUU AAU1ETTE0B 

; jj»4:.c uitu: -ft? 

s D3FF|ip7rF i r.FT-,vi 
:FU'F-FrF&P'7«fl<, , '*J* 
I KST FCDSiEDF r"3E 
: BBDBFFF.6HB3 TCBPB 
r"-^fcbBi'iJ1.tJLU(tFti 
i Jii2BB*M7Ff4TC , 7AP 
iOIErrrWt7IMBi3F37 
: lbM21t"S£03F*fOB7F 
i [7?eD< 7tCIfl7 KFDS 
. FIC3»4.Ei'< r 53EIJ?SFJ 
: J» l» l CTCtWCfcOSl 
; JeFflt^LILriLJI Sll 
; 71 20 . JCDT'TCIMTHC 
i -.Tip'-Tuirrstsi' -F .•* 

■ D7 3CIDDT I Ol BZC^a 

t D73e«»75rtfliSCFE 
i;l2W33EP»IiTJETF 



.3IT1 fa*9a* lD73eaQD7F]ElBlCl ,fa4B 

™ faa*i? !r.9fEa72ajcFEat2a 1 4F3 

,394 6B92B ■ lWEBC?ai4Fr > BBZg,3aB 

faOTjFJ . 1 arEBD2BBCFF. TaFA.Afa? 

fan^V. r«FTFFE»F*l IEE3E,4tllH 

,QCB aU u 44 ■BBCV2EV7L,<niIUbBaD 1 37t: 

5 ' B tB»52 I AE*2CDSU4J»: 1332.1 C4 

.2FC ftBffjfl ;FJ93cr;9J3E|.i|6Bir;p,3aZ 

,c,ha t.v*iM 1 1 i.'VLb-lti^ifaaacD.ra' 

ait tfl»T6 , i iTitT^apanMSMiii.acD 

.5C7 faB9H* iflLFSllii-.lWTEirSDFD^Sl 

1*7 faB»92 iCI»r.EE-lDlCIC»ln 1 5Clj 

1*73 61BBB |3BSCE,D!)'F2BBESIWB,2SF 

* 3Tfa A 1 Ban ■ 1TH7 I 1H-Vrf7»*FF i ,*r_3 

■44 faioifa ; oJtwj'.-*:i i taea.AijL 

??. 41 »2* iC&lOCD-j[l'?**4-3'.4Dt, 

.4.-,£i 61B32 1 !4C*C4FB|4i*9*E47,2|J4 

.JEB 41B4B iT»*C41MESS«i"il2» l r]B, 

3W3 41B4S i2B2B52<S43*»*e5f>,77b 

WJ A1BD6 «*5WI52B2B2»*57D.217 

SHE fallfa* -faf r47B/»AF7B«7ftS ..i;t> 

«F 61B72. ■ 'i*-JA54»7Ui-»i5i>i,2DF 

fa;n niiLin se>3A!3^f fai'biVk 1 faL.ivj 

/*|i /iLnriB L7nsij.r,-.9j'.ft7*7B7n.-,Bi< 

fTST fal«9fa !7ftiTBB7«fa77IFWfaS 1 ?f!'» 

,Hfi Ai a* i74raT2ir7flT**P2» 1 s«; 

nr 1,1:19 ■ iEHGiLSEr*7"Mj»is.;7i> 

4£0 41 7B :4b144 35?714FrSi4P.ja 1 ? 

,214 6i ja ivt*TA2iwmntminA.ic.i 



YOUfl SX>MPJT E R , M ARC H 1 985 U 










THE rROGRAM, whcr Tin, provide* the 
•Vic-20 with sn extn 25 k:yworcs where 23 
j re ;ommt"J> auJ twu die (unci ions. The ex- 
tra co.imianJs utilise sound, colour and 
graphical aspects of the computer. Then- is a 
rescluton of 160 by 192. Double height and 
uset-ddintble graphics are catered for in the 
package Thee it al»o a special key scanning 
function to a'low mult -key input similar - o 
[he Inkev function on the- BBC machine. Col- 
our manipilation to produce animation ii also 
3 key feature. The use cf tckenised keyboards 
results in no jpetd dccisus?, 

A lis: of comntands h provide* on printer 
paper plus ivto airna poirxaras. Poly Orpin 
j „nd Ee^kcepe - . The demos contain no Pokes. 

As the program is of total machine code ii 
« ill be iuipussi'jle m convert even, to a 
machine like the CBM-64. Most computers 
tnyway have i reasonably extensive Banc 

Loading — Press SKifl Luekj press Run 
Stop; depress Shift Lock and press Play en 
tape. 

1Tic Extra commands: 



I OPEBA'l »>N MODES: Each mod? com- 
mand .niUiaies the normal Vic-20 colour 
ind sound channels, 
VlODEO — s:ts che nornii! ttxt tcreen, 

MODF'I — irts nnrmal screen with 102 
definable cha'acttfS. 

MODE2 — >**ts the 15 line screen wiih 
double lieigtlt characters. 
MODES — sets the hires screen with 192 
'ines or" ICO pixds,. 

I COLOUR COMMANDS: nit colour com- 
mands car. be usid In all nodes. 
:nk x — sets the current int colour to x 
(0-15). VaJueE above 7 sets the miltiuolour 

Tirutp 

AUX a — sets "he auxiliary colour to x 
10- IS). For use in multicolour griph.es, 
v'DU K,y — sets tie screen en our u> s 
(0-15} and the herder colour D y {0-7}. 
iimi x — chrnges each, colour on ;he 
screen by x amount for example with 
GCOL] black becomes vhiic and white 
becomes red and yellow becomes black etc. 
0001,7 reversei uc process above :he 



GwOLl causes a fashing effect, ParTi use 
with multicolour characters. 

GCOL x,y — charge* everything wit a 
colour a (0-15) to colour y <0-15). 
I SOUND COMMANDS^ 
VOL x — sets volume to level % (0-15i, 
CHAN x t y — seis sound channel x (Q-!) to 
value y (0-25>). 

$OUHD I,J»K,L - jreis all four enamels 
ic tht value, of the Viirij jkv 
I Hi RES COMMANDS. 
CLG — Hears die hires jcreeii. 

SET x,y — slots a pixel at column i 
(0-159) and line 7 (0-191) m ii* current int 

colour. The EOp left SOftacT is the migin 
(00). 

RESET i,y — tin plot: th: pixel at column 
x (0-159) and line * (0-191). 
I SCREEN COMMANDS. 
AT xy puts cu;aor ji co'.urcn r (0-2 Jl 
and line y (0-22), Tor use in modes 0-2, 
CLS — dears tear: screen, Don't use in 
mode %. 
INV — ,n verts screen display, A second 



Program 2. 

8 SVS58648:P^:INTCHR$(8)SPC<49) ,, P 
LEASE WMT :" 3=£ : rl=3.fi: B=3192 : 00 
SUBS : A=2 - E=673 : 3CSUB6 

1 IFSOi7711STHENPRIHr:PRINT ,, CHE 
CK-SUM ERROR" :PRIhfTiEND 

2 SVS680:3V35664E : P0KE788 , 54 : PGK 
E782, 228 :SV35I*98: PRINT" DFR Ftf 
TENDED BASIC" --PRIHT 

4 PR:NTCHR*(157:' (PEEK rS44>-38> *2 
5b-l"EYTES FREE" :P0KE198 . 8 : NE*I 
G FOR I=6T0fi : READA* : FORJ^Q T038 : F- 

teSC<A'$>-S5 : )*26*fiSC<MIM(ft*,2')X- 
6S:S=S+P 

3 P0KEE + I*39 + J .P .n$=MID${ft$ ,3) :N 
EXT: NEXT RETURN 

289 mTf\ BGEUr-PSEfiFHDJRRBJGDJHTB 

IJ'3CTHTCNF0CHhTI*NGUCIFeGVGGftAFEA 

LCEJTJDBGJ6ftTfiTEVJ6AHHH 

281 DATA JEB'jJGBNBWHDiVIAJMIWHLG 

IGVGNHSHDJRftBIVIAI'QGKGVlBJ-ALftVEBH 

HSB JR ABHS I VHD JRftBGE JRAB 

292 DAT* IftJHGI'5VHSEf!GUHS!!D.JRnBJ 



GftQHIlfllHJHJeJHDSftlHTJVJGBfiBKAPE 

WBMHTHWF0BIB0CEI-2KVG0FC 

£83 DATA CVGEJVHUJGhIHSHDJDBGAOJ 

GiEWJLHSHDJDBGBWAFBciICJVIAJLCVJFH 

GiEOC'fBAhRGEAEGVEShfTHl-JFO 

234 CATfi f^ZH'TTGM^VCEIZH'v'fiKGMHDH 

CBSF15J«Hl>HBBGF]>JRBSGFACEEJRAft]>Sft 

HHZt>AEHAi4B[EE:E:EEBlEH£I 

2S5 DATA BTBICABICHBIDZ3IERBIFEB 

IFVBIAUEJCAEJrDrJJ r VBJHF3JHREJIME 

J I TBJ JCEJ JC1BJEABK IEEKCC 

266 -DftTR BLAHHZCZDBG«HPCPCVHHCPC 

YIDCPCVHRCNIECVDAHVCNDHIIDICQIFD 

U l BHWCPCUCNHVDFDBDHDnf-0 

287 DATm DFCRIEi5EDFCRIECTCPJ)BHWC 

JCNCVIEDHCOHRCPCUCNCVHVDCBH IEDED 

CIECVDAIGI'HDCIDCQDAI^rC 

268 DATA CVCNCPHPCPCUCNICCXCRIJA 

AAAfiiAAAAAAAAAAflAAAAAftBGAVrvBGIAR 

eHTftAIAABDSHTABIABSGNfiA 

£69 DATA GrirDDJrDDLGH^UFDDKGNETF 

DIMGVDLFPDJHSIAJPIWDMGK3>KIVFEL=KI 

GlBGIAJE'3Hfi 1EGC0IXGHHKFL 



i ■ 





98 YOUR COMPUTER, MARCH 1985 




1WV tioruiali&es screen, 
PLACE k,e,s^y — Puts sercec code 
character k on the strccn with colour : at 
column s; and Eine y. tc will jeocpl anj 
multiple o ot'foi parameters.' It works in all 
inotlns hut the tcrteo in mjiHe 3 it trwtwrf a* 
20 columns. To get lov. r er Qt*e characleis in 
mode 3 use POKE 9329, J 3<> aid normal 
upper case h POKE 932%138, 
L T PS k ~ scrol s screen upwards « times. 
Don't use in mode 3. 
DWS x — scrolls sew en down x times. 
Don't Use in mndt 1. 
(OTHER COMMANDS, 
CLB — clears rhc keyboard buffer. Poke 
IVS.O Hill * stops prcgram cxccuiun for i 
60ths of n second si lull )0 will wa.t for '/i 
a secend. „ 

CHAIN — endi th: progiam and loads and 
runs ihe next progrun or. tape. 

PUT x o'.itputs acdl characters z tc ths 

current output cevbe. Can haw any 

number of parameter! eg, PUTii,M locks. 

Vic in lower cast. 

R?Ti — repeat key facility 

RPTO Monad 

RPTM — Mo keys repeat 

Rl r ri28-Allkc?9iieptiu 

UfX9 1J,K.L,M,M,C,P,Q - creates usrr 

dt Dues character I (M£) where I is in 

G?«i!n cedu. Tin: remaining ■-■ i >; h i variables 
relate to the S tines ofpbcdk To redef.ne a 
duub.e aeight character its. screen code 
nomher must je multiplied by 2 tor the. 
vilueofl and thei: reddine two characters. 



Program t, 

2 P0KEe4e.l6-S/S5964a PRINTCHP*: 
0)af»Ct24>"PLLrtS£. Mrttt HHlL&f'bhv 
(3D 'L.CAI>|Me - 'SPC(£av 

4 PQKES72S ,& . P<j\iE3r"yS ,3 .PQKZ4Z ■ 1 
;P0KI44,3$:P6KE45,3 P*K.E46,39 PO 
-E 199,1 P0KES3L,i3i 



Only th? first QA Hnnhl^ height characters 
can be redefined. 

KEY(x) — :* a function rnd return, a value 
of cither or - 1. If key a is down - 1 is 
returned also C 1 is ret jriVid. The vjlut of x 
h*% to he in PF.EK(l*7) key coce. This sort 
of key testing allows mulli «y input. 
lFKEYfX)THEN - tests ht key * iWi. 
H-NU)KFY(X)THEN - tests frr icy x 
up. 

CHAR(x,yi —is t Fnrnrrinn anc rvurns tie 

screen aide of the churicter at pasiliun x 

and y . Not For use in mode 3< Parameters in 

commands can be variables. Expressions. 

Formulae or even numbers 

To enter the program first save prolan. I 

on tape tken type ir pmgrim 2. When it rtns 

without a.) eiror message save ii after program 

1. 

All commands an be placed within print 
ut'sjerrents between senicdors. If a command 
is entered directly from keyboard a syntax er- 
roi miyht result. An extended ba*ic command 
aflir i Then StatCKetit must tie sit reviled uy 
a colon, for example: 
IF( i60THEN:SETX.V 



1 

KEY CODE TABLE 










— ■ 


C 


1 


2 


3 


A 


5 


6 


7 


k3 




c 


1 


■$: 


1 


4 




3 


Q 


2 




1 


2 


w 


A 


°A 


2 


S 


E 


4 




2 


5 


R 


D 


X 


C 


F 


T 


6 




K 


? 


y 


G 


V 


B 


H 


U 


8 




4 


3 


I 


J 


N 


M 


K 


O 







c 


+ 


p 


L 


I 


• 


: 


e 


— 




f 


z 


% 


■ 


1 


■L 


m 


7 


1 




1 


( 


) 


I 


1 


11 


?3 


f5 


f? 





: = CTRL# ^STO^S^CBW /=LSH1PT 
?^Upauow , = HOME{=[>ELJ = RTN 
( = CF(RR)=CRfin 
For example key H =5 xB + $-4ii 
C-RL key = 2x8 + C-*6 



21G J'mTH ftFFODS-rTHCIACTGNHHSMFDD 
JF£I>LGNfiUF]>DKONE VFDDM'5VPLFPI> JHSF 
PCOF'3IWLLIftAJGKDMlV]QFE 

211 5nTfi -J<jftOFEI>MGJr'JASE3ncrDDJF 
OISAVIWMFOINGNHXFLftFFOGNBFFLAI>F 
0«NftVFLftEF06Nri IC u C0 IXGQ 

212 D*TA JVFieBJGAPHUIOftPIAJNeNJ 
GFr'E^GNAGF&BNONAAGMFPBH I^EM IAJ0 1 
L-JENGJENHTEGIAJFGNHIBGCO 

213 DfiTfi IXGNHHFLAFFOGNAOFLAAFOG 
NBJFLABFOGNf^UFL^CFOONAZFLrtDFCLSG 
NAAFDHfiDSCiTR I VC V I0BHE6 
21-1 DATA IAr^CGrlB^HXACGOHVCVAKiyB 
GIAACFL-EACESGRAOFOBPAPFDHNBC-IAP 



;bpapak^kakp 



INFLAOFO 



215 DftT^ DSE;GIAACAKAKAKftKF!>HNB6F 
KriCEPriHFiFNNFDHHGRnPF'OBPAIAFHNFLA 
PF#SGRA0F0BPJ6F&HNBGIA 

216 DATA ACBPrtPHFHNFLAOFODSBOIAA 
CBPAD^OBOHXAC^EAKFODSBOIAACFLAKF 
0«36AABGHXACGBALF0IVIQAI> 
2 1 ^ D A tA I A JL D S E G I AACFL JU A CB<3 H KA 
GFLJVACGNAQFDBNF&EPGRJUACCUCHCWC 



MFDBHGRJVACCHCMCHCWAKAK 

218 LATA ftKAKCUFDBWCWCWaVBXDWBXB 

MFDBMGEt=iAEAFyEC(':3.JDXCEIVB.QFDB0.6HA 

ASSA^AVEJBMF0ACIHBPf4UIA 

2^9 I-ATA JMAVDXBOFDBOEABPAHGyAHiS 

O6NnBHUEkAEAKAVF0JPJAJr.rHRD0rP30O 

RJQBIHTJAIf=AHGJBNAVEEFC 

220 DATA ^EEN^Ht-tHCfPKr-lDSGNCVFL.J 
dBIGNJVFLJREIGNBXFLJSBIBGFVBiSiNJ 
AFLJ4BIFLJRBIGHARFLJSBI 

221 I-ATA DSBGIAACG0GEABGVESHTB5J 
GBEGNFSFDBNGNflHFCBMGGACGEAAGVEHA 
VL-KDXBPAHFPB^HS I £ JK I WEN 

222 DftTft HUIAJLDSFIFBHNBfi'HHACSN'F 
SFI-BHGNftflFPBrtS'GACGEAASyEMEPAPHPH 
NTAAEGJDXFPEMHSIn-JHIWBN 

223 I>ATfi HUIAJADSBSIAACAVDX^GGOG 
JDWDKGF0HIUGGIAJSH0GFIAJODSBGIAA 
CCUCHCWCWCWCHAVEBAUFD3N 

224 jAT* EAAKAK^KFDBMGEAABGHXACF 
PBp-HSHKAIIAJF-llVH^r^BFr'HCGNFBFLEPA 
CCVE rHOBGIAACBGESJIGEAl 

{program i Continued on n&xl page) 



'OuROOMPuieR.M^flC-i iaas w 






(program 2 continued from previous page) 

225 DATA 6VESHTBSIAAGBGHXACAVF0J 
FDSBGIAACFLFIACDSGRAPFOCVAIFLAR- 
OBSEG I AACCUBGEN 1 ZEAGOHU 

226 DATft FIIAJKDSBGIAACCUGJIGCUG 
N. VFD IGGN IJFESCEG JE IZEAFft IGGNFOF 
D I JEAGOHUF 1 I A IUDSEQBG I A 

227 DATA ACCUGRAFFOHTHWJGCQBGHXfi 
CCUGNAGFD6ZEGHXACCUEGHXACG0EA:aA 
^JGAKAVEBAHFQACIWGZHUIA 

228 DATA JMFD6YFDEP£JGZAVE3FCFD3 
36EAAEAFPEPEAFPe iJ GEABGVESHTBSIfth 
SEGEQAAAVFGGZDKDSEACUCW 

229 DATA CWCWCWCWAYEBEVFDHOEAAKA 
KAKFDHNBGHXACCUBGHKACFDBHGNFSFDB 
NBGHXACCWGOGEAAAKhPDXJG 

239 DATA ACGEA IFCHJHUEWAhGNAUAYl> 
XBHFDBMFOAC IWBN I AJBGEA AEPFPBMG JB 
NCE IZFSF&BNGGAEAGEHBHBN 

231 DATA HUIAJPGJBWAV*XHJFDBMGNA 
RDXBNFDBNGEAHGVHNFPBMFGAGJPCYDKB 
KBG JGHVBGGC IHF ICUBG JTHV 

232 DATA GNAAFDBMGNAGFDG2BGGC IMF 



IGGAVAY1>XI>XF0ACIWG2HUIAJHFDGYBGJ 
NHYEAGMGVGYGrlCYSG ID6NAA 

233 DATA FDANBGEOAAHT ITFOAUHTIVG 
U AGCE I2HVAKGHH&HCBGCLHBHBBGCUC VE 
OAfGJES IftftCHGETHQFSnVFE 

234 EATA HVAABGDUBGIUHRAFELEQBGJ 
HHVGEEGFPCUGPPHFPCUBGGOIEGJDXCWC 
WCI«G0BGEPELCVJ7FLBG-PGJ 

235 DATA DXEPAHGOEG-PBLFBEOGREHF 
PCVJyBLEOJGACGNJVGMBGFPlDEAFLBHF 
PFAFL EflFPfiKDSGNAB IQnA JG 

236 DATA AEAKHUIAJSDSCCBSAAJVAnJ 
VftftJVAAJUAAJ r *ftAJVAAJVAAJVrAJVfttiJ 
VrinJVA^JVAAJ'vAAJVAAJVAA 

363 E-ftT£ rWEilAACIWETDSGGAFHHHUA 

CGBELAAhUftOJNGGAHHHBVBLGBAEA^HUn 

Q JNGNAQFLFGACCYA Y IVAAAA 

361 DATA AAAABGFTBG3GGFACFICUFHC 

UEGGFACEGGC IHH TAA I AAMHPGB JGft 1 3GD 

KGBAAACHUAy JOGJES I AACHO 

.282 E'ATA ET-JOESEAGMEAGOGJDXDSnAA 

AAAAAAAAAAACGHOFBHOEUHPBAHRIUHRF 

EH VAAAAAAAAnAAftAAA AH JJA 



Demo orogr&n — Beekeeper 
iu wsuBiyuy 

15 9ETK* in.J=> IIH i3OTO20 

L? ,>l.'.. H=r.V DK-'.Kt='B" J - , Ki = "pl" 

IS JF^v>S«AHI>tV=OTHEHE:x^ &y*H 
^e I =>t . W*X+T>H J=Y.^+DV IFKC60R 

&>£& t Hi. WM* - E -L > ■ I 

27 IFO*AS<X,Yi«36$*F04f 

2s irdMftR(KjV?-M«oToea 

40 S=S-1 F0l?Z^^T(i75SlEP-l:CHft 

45 GOTO?!} 

SB S=S+1 P=P+:'F0RZ*225T025B CHft 

NS,Z r(E:-:T . CMCiM2 ; e 

"P? PRINT"H"TnE.-i2jS"B "IFJ»C£3a& 

7033 



OLL.Vt<U0,Z:CHnH£._2S+Z-Ti5 NEWTZ 

,TSUJNDW,U, 8,254 

8* CLS PRTNTATe,3-VC>JR SCORE 15" 

5"' 25" -FCflVci^TOaST^P-.eS -\*OLV : 
NfcXI 

93 [» r S PPIH - *"* e"ANOTHER (-0 ' 
(V/K> n 

95 [FN0~KEY<231 THEN HALT J£ €0T»9 
6 

itftf MODE0:CI_B.END 

1000 *>>€2 : UT'573 ,254 . l£4 , 56,254 , 
130 ,-173 179 , 173 WQH, 1B6. 186 , 17 
B,Lva h 17B.13G,£54,B 

1001 UDG72, 3^.24,24, 36, 36 126. 12 
6 ,66 UD073.66 , 125 ,12s . 36 , 36 ,24 2 

4 . 36 

1602 UI*G74,a,l2b,l£?.l65^65.1b5 
. 139 , 153 : UW3?5 , L3S ■ 129 , 129 , 169 1 
53 , 1£? » 12b . H 
1003 SRINP ill EEEKEEPER **f; 



a _ b,3; ;nkvget the homey pots wt 

1 AMD AVCilt THE ", 
1005 PR I NT "BEE? Bta.",AT6,6. [KK2 
"ONCE MOVING YOU CAN'T STOP," AT 
3,9, INKS" VZ— UF/D^WN" 

ieie pfjintat3,iq"cr&r--lept/r:gh 

T" ;AT2 ,13,1^1. "FRESS CTRL TO SG 

!":I=9 

1015 <3C0Ll,i-l; FFNOTKEV U6>THEK 

HrtLUe 1-1- r. oo Toia 15 

1820 CLS VDL0 , : PR IH T TAB- 6) "QSQO 

RE' i" ." ": 

FCRl=eTOl:FCRJ=lT0E5 

162S M=INr<AND:i?»££) :V=:NT<RHD< 

1J*13)42 tFCHAf?CK,V>O320R<-;=ieA 

NtV=7>tOTO1025 

1E3B PLACE35+I 6 + J ^YlNEXTJ,]:* 

= 10:^7:D)!=0 D u = 9:P-e 

1E40 FCRIal2eT025T4 : VOt Tyifi-SOUNli 

I,I,I.B:NEKT-S0UNDB.B J 3.e:<:LB-RE 
TURN 



OerftO program — Fofy oraan. 

1@ GO3UE1000 

2G !;=6:F0RI = 9T02.5U>*e :A*CU=" 

";NEXT 
2^ POR-I=8TCt«:IFKEy<Ka>)eOT053 
3B NEKT 

35 0=12-0 -VBU0,7 

49 F0RI=9T02:CHANI,S(I> :PRINTAT5 
+I*5.8A$CI> :NEXT:GOT02S 
56 S(X)=A<I,X) :A$(K)=N$< 1) :X=X+1 

IFH=3THENX=2 
68 G0T036 

1696 H0DE9 : PUTS : VDU8 , 7 : VOLS :0=3 : 
N=12:LaMA(H,2> ,K(N) .3C2> ,N*<H>,A 
$<2) 

19ie F0R:=9T012;FORJ=8T02 READAk 
I ,J) :NEXT rREABKC) ,N$CI> NEXT 

teae fori=ito8 inki F0Rj=eT05PR 

INTflT2+I*2* C I>3) +a=8) 1 15+J N 1S " : 
H£<1 



1925 IF I03AHD [07A-4E K>8THEhF0R 
J=9T03: INK9:FR[NTAT2-H*2+lt( l>3) 
,15+J,"E ' :NEXT 

1836 NEXT: IHK8:PRINTAT5,16;"flSilD 
ttGHrHJ" j INKl.;AT4..15; li aZ^:H: i v«BK 
NBRC" 

1946 PRINT'*ai*» POLYPHONIC ORGAN 
**" ; TWKP):PRIH-AT7,4"CHAHNEL";AT 
5 t 6"B 1 2": RETURN 

2£9@ DATft223,19i^i28,33, ,l C ".225 
,195,134,41, "C#", 227, 193,141, 26, 
M D ", 228, 201, 147,18, "D#" 
2692 DAT=r£3G, 264,153, 34,"E ',231 
,29^,159,27, "F n , 232,216, 164,19, 
hl Ftt" ,234,213,178, 35, "G " 
2895 DATA233 , 213 , 174 , 43 , "Gtt" , 236 
,217,179,28, "A " 

2616 DATA237.219, 183 ,^8 , "fi#" ,238 
,221,187,36/'B " ,239,223, 131 ,29, 
■•C ■ ■ 



igO VOURCCMPJTER. MAfiCM 13»5 



A 



< 



4 FREE i 
WAFERS 

LUDING ' 
SPECTRAL 
WRITER WORD 
j PROCESSOR; 



As a result of 
S WIT'S purchasing 
power, we are now 
able to offer the 
superb Rotronics 
Wafadrive data 
storage system for 
only £99.95*. But 
hurry! Stocks will 
not last long. 
You've read the 
reviews. News your 
best chance to buy! 



« 












1^^ 


lA^H^H 






_^^ji^^3^^H 


1k\ _jB S^^^^b 






IPHr 


ROTROHKS WAFADRIVE 

S. k , l - 



SHIT S pecial offer! 



Wafadrive only £99 95 



Integrated System 

TheWafadriveisa 
rnmplefe fiyfitarr whir:h 
contains the micro interface, 
two 128K drives, RS232 and 
Centronics ports, all mone 
attra cti ve I y-sty led , co m p act 

unit There is a minimum of 

connecting leads and no extra 
boxes to clutter the desk top. 
Like the majority ot profes- 
sional systems, the units are 
dual drive. This offers the opti- 
mum balance between system 
flexibility and cost. Built-in 
serial and parallel interfaces 
a How the direct connection of 
justabcut any popular printer. 

Fast and Reliable 

The Wafadrive achieves 
very fast loadingand saving, 
but not at the expense of 
reliability. Extensive research 
and the ubo of high g rade 
mater ial s e n su re th at t -ie 
Wa f a d r i ve wi 1 1 g i ve year s ot 
dependable operation, Data 
integrity is on a par with 



floppy disk. Three fully 
internhanrjeahle blank 
wafers in three sizes - 
138K, 64K and 16K - are 
also mt i udec low capacity 
wafers give faster access. 
They are therefore most 
suitable for program develop- 
ment applications. The high 
capacity waters are suitable 
far mo re gen era I data storage. 
Loading rate is well over ten 
ti mes as fast as cassette! 



Software 



Armed with the 
comprehensive user 
manuals, blank wafers and 
superb Spectral Writer 
word processor, you 1 II hsve 
a professional system to be 
proud ot. bee the coupon 
below for details of the 
rapidly growi ng range of 
software to enable the 



"Pluc VAT sre) £y.oc poet aid packing 

programmer end games 
player to exploit the 
Wafadrive system to the full. 

Buy NOW] 

Cheap, reliable mass data 
Storage for the Spectrum has 
finally arrived - make sure 
you benefit Tram SMT s 
special offer. Clip the coupon 
below and your order will 
receive immediate attention, 



FOR USE WITH THE SINCLAIR SPECTRUM 



float* **nd m* *im*t a*d^p*ap.lii[.|: 

HOTHONCS5wclumWBifmrlve(5> 

l6Kunr§f » 

HoatiroWNIffl-niLKill 

Spam-Wfl-R.'Smdri.-ii'Airr'ck.Lilrin 

Arrnrk 

fl^arQnYYcrrUcMig 1 ; LnoiyL.undrv-' 

WurlJCui 

Slarbikc 

1HP Ktclini <*Hfo 

nsKZteid 

. Cent o'tlaHid 

Aii^i*oB*n«lu«c- VAT »r,dP*P 



.■"■HUM ram 
iu E3.45 cam 

in' nn,-,i , 

la E9.*bt4d 

■i E7.45cam 
lH **« 1 

iWH.OjHih 

£ t-$.aSc«ei 

total:: 



D I end oss a crteque'PO* made payable to SMT 
I C debit m» Access Barclay card' account no, 



Sgna ure 



Hiii* 



/•aunts*. 



Send 10 (fiO Rf. mp >eq u fed): SMT , F RlEPOST. Crien t 
h often, Towcestrr, Nortbantv hN1 1 9BR 



Plesstaisowit 
days Tir deli wy. 



E5 

VCrSrSG 



SMT 



Mall ntrlwPffWflfltnn Rrviloiyfifiriitilflnfl niimhiv SflflWiSJ 



^r4^- 



Ffcgr&n 2, 



S£oa I 

zi . i 

riOi; 

iCO ' i 
no i . 

CO! : 
SCOTS 
£C0£O 

:U'it 

scete 

scia* 
= c 1 . : 

?£*** 
*ft"tr 

A." I Si 

fttlM 

t ;.. ■■ 
z;.~i 
fteaoa 



4C24.1 
SCfiBi 
*CS*i 

■ .-. .> 
*Mn 

• o - 1 .- 
68320 

:o-i = 

sew 4 

5033* 

o - p a 

zCZTt- 

. i?: ; - 
f ec;i 

6iM £ 

o t>^ i ^ 
6 W i : 

-. .-. L 

v "J*".' 

'. asa . 

fr£S44 

ere*; 

f «f ? 

eoGSs 
-.--.. ju 
: co i C 
tC6: = 

. -•--'- - 

a «■ i a 
tocgt 

BQ7V4 

S072! 

■ o" g - 
**?7*4 

*<*-sa 



iSS^i^i::::: 



ijo-czi:- 



3E*e:-;jo:»c :;f c 
i*c -»r ■-:*!■:«:? i! 

L-. Jf : s - 1 - .7 — 

5iCf i -fi? JE1SJ: "5f 

■ f i-r -=fl;£^i 

r **? i ?*r. 

410574=7*1 3 i« 

• . . - : - : 

■ - .', •: «t :- 

ii^i "i I i i 0? 1C LiM 

:«c[ s _ r =■: _" _ z-:i : 
:iEij= -31*^4 : 

1 . = :■;.:: F""if " " 

Oit 133C"cB» SflFefi 
;[,; ■*=--■ .fia^Jfii 

E04BSE"] -esiun 
iftJi " . i . :--.: LiEZ 

EEr:-Ei _ :^E-f ei«o 

BftiK3E7IE.5Xli.4pO 
liESsi 3E7i£R,J| "J 

CltiEiBJECJCL M 

' ' ;.t>i$aiftC 

'IVLOrfL. IfKii;"'; 

i'Li'*:. L rEDf33*~*l 
F-cp - =-■ - : ■*"!« 

-ze: ":i:?MC!?3i 
^iiA;E - :; j:r >i - | 

seTi ; .--" -"F 

. ■ a - f (•?««;*?! 

■ :?s ?r .'cc-i*** 

Bicc-cssssMoawa 

Alir^pplSS 

?9f"EeiCftie*ssi i . 

ia6*.'i««j5H)ep 

13£03e7lSP5»»7: 
2S7;isea71ll i^^O 

•- "=i 9tCE 

13E3Uai 

-- j .. 

• ■ 

iieoiie; 
■a j 



= "- 

± i» ■ 

• :Cii 

": t 

= :Ef 

= 61s 

= Izz 



• .B3-- 

■ »49 

± s;s 

■ *fl = 

* 4S~ 

s .23; 

= . 43 ^ 



». , J6F7i 

'l*r.EC 

-if-. 

■ = : - . l« 
.^ — 

SS7:EBfl ,? E032E*Ll' 

iii*Mfl-fift8at:S8 
4SFc:so£C6-:c-E-fte 

c ICC ,i*.£ n.':.c[ 

■_ . .'I ' . '- la 1 iJ^l.Si 

?::?er<:c-?B&?CD 

i^ECJC 5f64-:t>ii*f6B 
Liocr- r 3Zi>r : "" t:r r 

fpit(»-p 

e92L407iOU9dVC ; 

jmkl;;:;^.,':; 



* f«4 

• -e: 

- .;. 

I 494 

* .Dl . 

. .1 - 

CI 

• :u 

■ JSf 

• "ii 

- :3** 
> 72E 

■ 41* 

« ?4* 

?- : 
.izz 
m f7i 

» *s; 

■ A1- 

« Sii 

■ ; (Si 

- ::is 

I IS 4 J 

6zO 
= 4-15 

• 790 

J i8p 

1134 

• J2XS 

«c 

^- > 

101 

:ae 

mi: 

E6 _ 
= 47 

c; 

-£fE 

: lzc 
iL- 

112 

U9C 

4t; 

CS] 

S35 
|ft( 
E04 



«p7«e 

sarvfi 

. 91 g 

*o*a4 
*«i* 

*L>J4J 

fiefs' 

■ r -.' 

BMia 

£0*iO 

s8Ji! 

sow; 
eo««o 

*0J*f 
4Ot70 

♦MM 

r."- • 

e laei 

61*1* 
6 . % i - 

- ia?e 

- isr- 

f _;io 
;.;.. 
f _;iz 

. _:.-.; 
..... 
t LIcL' 

61J8€ 

auis 
= ii*+ 
bus* 
5i if ^ 
!i:*j 
ei:'* 

»i«16 

I Hi ■ 

f lei A 

f 1S40 
f _c4 . 

. . '■ 
SLi&i 

Siase 

tiati 

* i « ; 

613M 

H^i 

(IXC 
5137* 

i ::j4 

SL.-VM 
■. ; ivV 
. i 10 
i ..•■ 

• I ... i 

CJ.4J1 

*i44: 
? iii.- 
' i i . . 

£1*5 J 

- ' 4 : " 



t>-CCBi;i4iCSE5C4«C 

OLLi. :::liee9S3ee 

b c t'< b ur c iei Fr c e 
diCtVJOC El l*Cf E3 i 
l.l'l!.i . .'.-sIC'-BOZ 
4&C4l 1 C£}ECDCE&9C9 
■.UliO£*i37C9AFC« 

IJO^COl-: IJ071O4 

0it»e:5*58e3BEac 
aTa^JTii^+ELisa: 
e Ha<L* i:++EE*iOF 

,*i'rr _ r z r« ~ =■* ii ' t> : - 

if CD3C5E 3£«£ 7t-i 

i:5J«Ee:^M..L--.. . 
c: lcici^jLi 
.Lt h L : "■".: :=■=;■■.►-- 

. ,t l j'.-. :ibmhii>e-e 

...- ii: :0."'FF»flCf 

E;TE2t'S.:.iP?p-r«:n 

0»i5£ L4f~i-:E£4£j 

■ =:ec:: -:.-■ .-. . 
iit-'ft'tf-sjirM 
ees; :e:^e^:-. ■ 
. - ; ii-rr : 

:f=--iF = ;. iL " j,; 
;6:i£... .::jien 

£ E i B£ I E^ 7 1 j> JSe 

£e=ei... ajiisoe 

CtcBEiO-Ofl^STS* 
C &S 35* 4 ,' - *1 4. ■ ■ L 

OliflffvJ lliOiiBn 

■^JBlWlMCDKiOil 

"^j'OCiiiOOCC'JCi.- 

MeOC'7£lflI7I113I 

■.;»fc:."E frci-a;; 
■;i-3'!7;Frap;; - : 

q7E5SaffllJ3"'3B"F 

:: c TOFrf«ica«oi7 
:cc i>' :-.>■-,' »e? s -*;*■ 
:3106SC*C4il4i 'l 

ipeeco£}.:^t #.# 
cpeeocFCCBOseei: 
cweoiifcc;: . io 
4«4n4t±j4,, ;cc-* 

oioecoe.i i\ ,; T :n : 

OEO«£t BJCU11FI5E 

.. iT 4 :;<*[■ "MS MPT- 1- 
*iJE4Cl£iK-S I 
..>;. SO«CD3;30M 

c-i4 5i:4*'ic:'?4is 

S.'BBOeiiflt'-.Ti 

om:;o , , , i l'-.'efs; 

,■> (»f F^r r. - r - f»ir iv - 
■UF:=rt, 

7;Ef5E3«--- ■■ 

i.;::::v. ■ : • 
:KSi:of-«iiot5a 

liny , .z-ict 

:i*'o. . o::i?4!> 

. \.- ■. .'■■SJEDir-: 

.^ L «L L " -L ACCt7Jf 

: j-iF-»*-- -I.-.-:: 

■2K-BSC ?:7EL£B1. 

jt-i-n ' [ : f-OECCL_ 

CDri*J-4: 'JEtCiNE 
i^^P^-F 1. 0»,'CSi. 

O - 'n. • . s . 4 1 J L 

QftssecEEp+eji'i 
^;:3:iE?tEi.i4p t - 



--. v- 

S5* 
»» 
»5 

9B« 

VI 

57J 
BH 

*-: 

S47 

•i- 
na 

i n ■ 

lift 

81' 
8E! 



isji H 



7S7 

-. 

a*! 
5t: 

574 
K4 

iigo 

1142 



-i - 

tit 
lilt) 

31 = 

9" : 
M ' 

4t< 

ft* 

' - . 

.-. ; 

lit* 

10M 
lifj 

»4« 
*-7 

?-: 

BAT 

lis 

61'- 1. 

1464 

hi' 

m 

tfiz 



SJ.SS9 
613*0 

*1E5£ 
*l;fc^ 
Ci3t; 
*1S"*S 
«15f4 

*4 5« 

*4*a« 

; if:- 

• U , -. 
< ]*'.," 

»i«te 

* i»u 

, J,,, I 
lie ^» 

I ION 

ft 164= 

*a7ta 

417iS 
725 

73= 
$1744 

i ; 

: : 
: : 



~-i 



iaEEE6C6£'3L"Et«. 

1 3 ;■ i - ~L o u t. i-r" i<; i 

iil.''. .'L' ' *B if Ofil 

;i»7be iciccise: 

=5E£5EEi[:'-lp-EC'fr 

n-f^.i::+oi-EC'E^ 
riE:EECTf:4E*r" 
-^i:-£^o ; i7c: +ccr 
;i.+O^EC'E^E*C LT" 
E5EEE: EE-: _ J-' ' 
E£ESa.*5."l(JE14EC- 

-CtSC;.3frtSCEOE» 
:9-l3-aC412J00LX 

:fl*rC:'r^5FES*£0 
£SJ?^.EI-E33£71^^ 
■PtS < ■ it>C*4;3*04 

CB?5t).aOF92A3271 

.. rii32£3S7; 

23233B71EC423E7: 

c33oe:Do:eoj4EC8 

^■:--E[E£;0F4?4!? 
37S747P3CDRFBEFB 

cg:r-3E6eiiB76ec: 
sOicc:f E-isesonct 

-M- :■;:£." t^ficpjo 

EE:FIrr-^FC7>lE« 
f -V ?C34C:0!0Kt' 
-^FC>73C 

c 

E 



CB24. 

ttfl'2 
4 

. ■ 
i ■ 
; 

: i : J . 
z 1 3 J - 



z -■* e 
! 19J£ 
ilflM 

ii.0i<3 
it^Ct 

: i cue 

. c 0. 4 
iit!.i 
:iD40 

: a £>4 cl 

-*,- * 
ana 

I ..3'* 

. :.'; 

fa i :.■ 

. . ./ 
iaii* 

111!* 
£2144 

it 17* 

. t 1.0 

, I I 

- = z : P 
f £££4 



EEEE:Sii-C*Jitlil«r' 

«Fc -4££:i«iEC4.jee 
i t .seajEec50sa> 

jj£oe::j iiiF'JPf 
EtEiJFii.': i - ;" 1 )*^ 
bSje&*i i-F7:f-bci 

C91 lL"F.."l - li£BiCr 

4.": : jh ~ LC0K4*«Ft 
rro.- ■ •■ r-jC3?9E 
■ i ; .j^;C'E: t 
«Ej;a.'e"" 7^78310 
EB^rcfTKsasesw 

;E34X>:3ES9D73Ee4 

:e«rfEf';5JfOE-= 

-1 J '■■'^■iC'si"'' 

tecs- frrfirjr- 

" - = ," J- £ . 

o juec ** 7 .-■e !jt i j 00 

Eli 5C( 5£ :. = ..-.. 

EEliSiOSfCEEL'-.L: 

ci'.i«40j;ei«< j i 



,'i 

4 4 tlC 



. ; 



. ' ■. r>' . . JCij ; • '1 

, . j t' . : c i = \3 - : 

CSEE>4B-;-E"I7Eel£>J 

«rE?:-.i=3£7:£: 
;:4^'ii^5E£;i." : 
r-o;: ; .-zE^ir-ii ■ 

. .ij/:*i'E~ABi 

:'.V --'"I ■-■: 

■ ' ■ . 

_• . s-:rt.54 

j^ee: D2ecie::( ;: 

'ifc; i'*ir!Ffj«C4 

iEtEFE^EC^CizE'Ki 
(SiLHCEf aFECii: t ■ 
k fii^.- a = -i=-Fi=^ - 
ii'. L- i .'. ■ --«■' - i." 

- .' . L . f Oi 

JiUi9a.EftC34tK 

--: - ,i(i* - -jtup^r.-r 
•^ ;fe ;». .i'.-'c:;:: 



tcotufnuett q,i page 104} 




y^A?^ 



:o: 



Securifle IS a f.exible roschkne-code data- 
hindlide prCCfiiin which Ultttt'twes the best of 
the diUe'cnt ajiprf aches :o dam sKntge. 

Br*-ndlv sTcasing, pos dat abase piogramF 
fur ifae Spe:in.m car bt divided imiy ihree 
caitgorics according to fl-.xibilip.'. 

T!tt first t"jlcKon are truac procraiii^ 
drfii^-icd for specific daw, arid cquire 
m ad i ilea:] or. before the djtu can be altered. 
An UApiiiplc is i! pint; mm 1 wroi* ic left nil Of 
otr computLT pmes and information abum 
them such as their controls. '1'hi irformatHin 
wis held in cat a li:iei» umd wa* r;ad as 
requi-ed. 

Vi-'lien a n;w game Heeded to jc added, llie 
program had 10 be kudid. altered and ihen 
resaved. To alur the prolan **• thjt i: could 
store dau on a subfec such as I book collec 1 
tiofl,a mi)Of tcwtile would b: ncccssarjf'. To a 
usji ivIjl Klcw uuJiibfi ihO«l f i'OBrjiumiriii, 
th; progiam would merely p:ovkJ« a fixed set 
ofinbrrnaiisn with iw stopc of change. 

fht second category onsisrs ol" proKrtms 
whiizii dtcla-c a large array <.t the beginning, 
and yv»u input data iiilo the ckLiicmb. uf rhat 

I QZ YCUft GOV POT B=( , IUAFCI1 1 &fl5 



Jon Ellis with a data 
handler that does away 
with arrays. 



amy. Tbese eiemtius cart Ihcr h-,* sorted, 
listed, praitei eic. The whoe array cm he 
sav:d un i ape and rplonid^rl when feqaired. 
Thfse programs have the major idvtutigt in 

l ha d it a on any subject can be stored and 
handled. This tr.tans that twyuiers can use 
i he sumt program sfcdeto:! to handle wildly 
rhfTFTPit sets nf fan 

There tre, however, several major disad- 
vantages of this approich: the forrr of ea^h 
iien U dictated at ihe begmr.ing ot the pjo- 
^rann by the diro:ns«ons of the array; ihe pi<s- 
^ rails are often TiTinen in -Insir :iid 'hi'ir v>rt, 
routines jre therefore slow: ih;re is little 
scope for cross-referencing etc. When such 
prograns are [roplemenied at th; S^ectruai, 
mother maior disadvantage tppt&fs — lh;y 
WafTC 9 Inr n : ' Rfjwf This 1$ dtte to th? w>y 
ihai the Spectrum handles both strin? and 
nunber arrays. 

If thtre are any unu&ed ekments in ju\ array 




iben the Specturr. w.ll fill ;hew vilb ckhct 
spaces or zeros as applicable, 

J'his means that i:' o.k- piece jT data \i 
jtigoifieurillir lunger ihan ih^ r«*i, The irrav 
Will ha v.* to be dimensioned for tie longest 
item, and so space wd be wasted at the end *if 
the o:hef items This inljdng nut is knowi a* 
PiociusiLiin yssii^iriit.Tjr :irid is . prime: exam- 
pie o" fised length record itorage; 

Th; progiam*; in the ihird category do tvvay 
w th arrays and the it aprampanytng di;ad- 
vantages and jsc a variable lent'th record 
system. This ne,-ns that &nly ihe data is 
sirred and 'ink- space is. wasted. The*o pro- 
grams, ars the rrost ilexibk.% imposinj; few con- 
straints on (he data to be stored. These pro- 
gniTm ire, how*vctj difliculr. 10 wfitt s 
espedaiJy ir. Basic 

Todeiiftri 4 ^a^a'jast tyvtem ^te n.li<uiLd Viuk 
at tht tweures we would like ii to haw Some 
pf ibi fitctors Ki be takei into corsidsTa'ion 
:irv: 



~ 




Bearing in mind ill these points, I 
developed Securnle. 

Setiuiifil.: urou.il ie included ia category 
three. It ttiesa variable- length record xtnrage 
technique to provide ma*iy facilities in a 
meraory-elticient fashion. 

Securififc h a rtatonabl) large program is 

far is lypiog in gw*> 434r byte-": ofmarhiTir 
code and daia, starting from 250 GO. This 
leaves only 2525 bytes available tbr data on a 
16K Spectnira, bui a rmsstvt 156J3 bytea are 
free on a 4SK Spectrum. Ytw need a 48 K 
Spectrum :*i mtiT.Srnirifil* frnm t he listings, 
bui tape copies vill rut quite happily on the 
16K macHnc. Tapt ccpics of SccuriGle arc 
available :rom ihe au:hor a: |£J isimdge 
Drive, Knckit Wood, St, Albans, Herfoit- 
thit^, AL2 3*>R :ar£3.75. 

To enter Sec uri file Iron tile list. rig., you 
ihtuldtypc in and run I sting 1. This will pro- 
.iip" ygu lor the bytes irom listing 2 which 
you should enter in the iowj, tnunnj [he 
ch-erksnm when prmnprH The* t+nvkjuim 

should cu.Ti most typing errors. When Imirfv 

;d the program vill save the object code Onto 

-ape. Type New and then encsr and run 

i isting 3, Thi% will rcli»Latt the code down n> 

/ Type New and ester listing t. place a blank 
ape into ihc recorder and type 

SAVfc "iifctJUKl-ILh " LINE TJ 
This program shouli b» verified. Now type 
save ■•SECURConF 1 ' mnF ?nnrn 4")4r 
ind then \eriiV ilie code block also. Now type 
RAMDOMIZEUER 25000 
J in d the menu: should appear on the screen, 
Onct yau ha^e got a working copy of 
Secvirifilf ynimh'inld lm<l i up sind iher re*aci 
through this, section carefully, trying out any 
points that you do not follow t>n the program. 
SecunLi.c otleR. 14 ttrtCtions from a menu, 



each of which being a:cessec by pressing the 

key indicate! ir. red 00 ibe menu. 3efore go- 
1113 on to ihe de:ail«o; breakdown of jaci furit:- 
lion, some explanation of various feat ires of 
the prograir is necessary. T.iese features are 
mi actually fowctiora, merely subroutines 
which are used by scleral fiinet-ons. 

TVil- t&ftn editor: This ~k a ma jar rominc »*• 
ed by the add item and change iicm functions 
to allow yuu to inrui m item to the file. The 
editor presents you with ; si, een and a cursor 
w.iich may be mov^d arOLtidusiig the keys % 
6, 7 and 8 with Ops Shift -\r ihc top nf rhe 
screen there is 3 Space fo: you to put ihe key 
field — KF — >f.JOu: item, and also i spa.ee 
lor the tag iield — It To move the cursor up 
to the top line, you will have to ^lace ii below 
0itc e>f lbe*e spice* iit.d ili#n prist up 

Caps Shift 2 will thai) Re the state of tht 
Caps Lcck b indicated by the bar n ibe tor 
right comer — freen - Caps Lock on, blue ~ 
off! Caps Shift 1 will wipe die screen, giving 
you a blank page-. Thii ftmrtion squericd To 
place a eh racier at the curren- cursor posi- 
tion, just t>pe the appropriate character. To 
delete a character, move the cursor to the 

offending izharjcler and lypt a s-pace over the 
tcp. Cha.Tjct**"S siifh as | whir)' \Jsere 

previously obtained uiine. extended mode, an 
now available usirg symbol shift and the ap- 
propriate key — © is syml>ol s'lift Q, 

The following ciiarsclcrs siould not oe used 
ir cither rhe k&,< fi^lr or rtip tap field. 
althougfri they may be UEed freely within, the 
ittaa itself: ■>', |, i, I, I, ', },—- 

^Jfttrymg: l>iastiC instrucuon$ are queried 
by ihe message "Are /ou sure? ¥/N l \ Only i:~ 
yon pre<v Y will rhe nil met inn hi pwhlttcd, 
any other hiy resells in the irtsiructim being 
disregarded 



I 



RUfASiC 

«* <% "-.rir c-+j b. Iks * 




iMcmory consumption. The program 
should be as snail as possible, maxinis- 
inc apacs avai able for the d£ta, ■.■.-; ic-n 
itself should be s:ored as effis-ienlly as 

possible. 
Ia& tevj constraints on trie makeup of the 

file as is possible. Tfe database shculd 

be ab o to handle Items of different for- 

msts within the same file. 
lTh5 program stould offer the following 

basic functions: 

1} Ihe ability to append an item ;o Tie ile. 

in The ability to delete an iiem from the 

file. 

m i> The a&ildy to edit an item. 

ivJThe ability to Stors the lile on some 

nackup storage — tape, Microdrive 

w) The abiliti 1 to list the itoms, 

vi)The abilily to sort into alphabetical 

order. 
I A more advaieed database prop/arr 

might also provide same extra feature? 

su~h as croES-refetencing between I toms 

printer compatibility, a cioioe of storage 

rr.e-dis, sub^st extraction, file sectrity 

network communications uslrp the ZX 

Net. 





^^ ^~ 




Program 1. 


•z 


•I^EHfi S^3S 


=. 






^0 


OEF F4 -. ih* »3U 


:t ZZtE 


- = I 


- . - - 


? AND •«■ ti 


■o 


T CQD£ 


KC(S 


-iS- 


■ t ? an:: h a t 


1 


3" 




§s 


:i.i=- :-.5 


r * " 


.^ 




ZUPiJT *Fin 


:ih 




A<J 


FOR r ^f TO 


- a- e; = 




5G 


..ET M-.^C 


PR 3 


; - r. 




fO 


INPUT ■» 


=Rlt-r 


r h»: 




- e 


I-ITT =0 








oO 


FOP bal TC 


LEh 


hi "EP 


£ 


-Ol 


LE~ ZsFrt - 


'hi 


LE* tOtatOl 


iOO 


F 5»-C n • : 








110 


LET1 hash $ l 


j ~c 


' ,£T 


\83C+L 


123 


NEXT b 








1 VO 

T t 

IJ.C 


PRIWT ' = 


■ 


INPUT V 


PRIM 


if to tot 


ME 


peirr 


inpy< 


t r r i 


■ r - -.: L 4 i5)tii- 


$0 TG 


se 


L5£ 


NEXT T. 








; --' 


TH'.'E "SfiC 


:£. 


1 roc= fO« 


40-lC 










Program 3. 








so 


" H "+* 2 *■ 5 s 


= 






~c- 


FOP Fw*eC<? 


e T : 


iO*ti 




7C 


^Ei^J, ^i P- 


i- 5 F 


*^ 




S0 


:.£.■' - 








9 a 


-fti-zc n!I( 


?F 


■i?cse_ 




ie© 


C-flTH J 2Ci 


1 ^ 

» — 


1 T J.^ £ 


3 


SA Z ~ 


- _ 3 17 1 


-?i 






Program A. 








S 3 


pomc d : ^- r 


f V 


BORI Efi 


d. QU 


EmP s 


19x9 








= J 


PRINT - - : 


e- 


1NJ- fl; 


P5&£- 


5. "S 


ecuftir :^f 


| E 


"' S j ; ~. - 
',- ■--,■ = 




-;■ 


_c^t -i'ii 




230&e 


.-r 


BANMHrZE 


-ir 


2 = 0" ' 









/rij»Mr «/ kfvfielJs tttt '['here wi.I be many 
imes witen SitcuiifiU wants a pie:e ofinfbi- 
maiion such a\ the key field of an item m he 
deleted, or the Tiknanie Or a cknjcilc save. Ai 
tlies* times you will be prompted lo enter the 
informuiioB. The characters that yen type wi.I 
te primed on the screen. 

All of th.s iapui is in lower oase, ta obtain 
uipi.ata yoi will have u um; die Cyps Sliift 
key js iki a tyfewrittij there is no Caps Lock. 
You may use dekte — Caps — o tOrTccI a 
nis&kc. Any spare elates should be bulked 
cut with spaces. 

Break can l:e pressed aL iiliuusi any time, 

and it will short the finer mn, reluming you 10 

the menu. ILnvevei, Bretk should not be 

pressed while a tape function is ir. operation, 

(continued on next page) 



YOUR CCMPUTER, MAFCH 1985 103 



(continued Horn previous page) 

inJieued by lis: fashing blue/red bordei or 

tilt blutriydbw lines. This could resull in the 
corrupitcn. of your file, 

The report *'Tape recovery irror' 1 which 
may occur during the load, saw and header 
leading fuiuueJis is slighrl/ Limb [junus. It 
may roea^ cither of tw,> things; tie program is 
expecting a hesdei hbek and has 'end vnn- 
olher i ape block by oustaXc, or ihai there has 
bain i genuine tupe enrol. 

The m;nu gi ,r es the following functions: 

1) Aid in item, When you select ibis func- 
i it ii ™ arepresen:ed with a bla.ik screen and 
the cursor of the screen editor. When j«ou 
have finished making up your item you should 
move The cursor to the Inst character ami press 
Enter. If the key fie d of she ne* aetr is 
already that of an cxisiinr; item iln-i th* pro- 
gram will present you with a choice of chfiOg- 
inp the ntiw item's kev field — pitas C — or 
deleti.ig ihe old item — Frcss D, 

2) Clause an item. Apart from the fact that 
this function will prompt for a key fifld, inrl 
will then display that iterr, this is the sunt as 
the acd f.ern function in opiraTfon. 

3} Delete an item. This function prompts lot 
a key field of ar ittm, and will delete a fr.im 
I Ik file if it »xi«tS. 

4) Ei tract aiblist. "['his is possibly the most 
powerful function id" Seeurifile. When you 
hebut ibis Function it ".villi prompt I'm the ug 
fn-ld pattern that quality an item for bong 
pa:t of the suMst. This is b:s( explained by 
mutn; of an example; 

Suppose that your fie consists of a mixture 
uf bills for the past three years. The bills are 
for electricity, gas and water; You have decid- 
ed that the first chiracrcr of the tajc fitld fin 
any item will bt either E, G or W — depen- 
ding (m the subject of the bill — the iecond 
and Uiixd characters wi.l indicate the memh of 
receipt ef die bill — e.g. May = 05, 
November ■ 11 — and the fourth and fifth 
character* will denote the feat e.g. 34. The re- 



maining three characters will be uniefned. 
Now, using this lunctio.i you eou.d isk for a 
list of all gas hills by using the search pattern 
fl - The __ character in- 

dicates thai that particular character in die 
pattern is not sigaifkan:. 

To extract a Usi ol all bills ir. June,, the pat- 
ti:rn would lx Oft All bills in 
June IQJU wp'.ild require the pattern 
06S4 Note that the pattern of eight 

_ characters is ihe equivalent of listing all 
i.ems, When en lier the screen is fuUfo: the 
1 st is ccmplctt. the program will wait lot you 
t > p-rs» M! h^forf rcintinuing. 

5) Header ca:aloguL. Ftir security Stcurifile 
stores its files on tape .isitig a n on 'Stand ard 
format, which is however, q jite similar to that 
used for saving programs on tape — a short 
header bioct containing the program 
flenam:, f.illcwed by a block containing the 
progran. proper. This fjuctiott will read the 
header blocks created by tie Seeurifile save 
nutiae. 

Tt Bftl' pr nr ;he filenarii; <f thai file an :ap* t 
tiis being ihe name you must quc-te n order 
to load that file, and may *lse prim Locked 
UEidcrnciith th? filename. This indicates rhtl 
the password security option ;s lockup th;t 
file, and that vou wi.l nctd to lmiis' rhe cot 
rect password in order tj Lead the file. 

6) Key fidd sort. This fumticii sorts the litt 
trf" key liclds into alphabetical ardtr, 

7) List items. This fvtnctioB lists tie key field 
find :ag field of" every ititsi in the file, paL^inz, 
alter ea:li scrten for you to inspect the list. 
Press X to cor.tinue listing. 

B) J'riner toggle. This fraction toggle* the 
printer option between Or and Off, If the 
prlntrr toggle is On ihcn oirpu: from tlm 
following funcriors is also d Minted to the ZX 
Primer: E<irECl sublist, List items, View 
item*. 

9) Qui 1 , Thii function is queried before 
Sfcurifile and control ii returned non 
destiuctively id Bisic. 



10) Recover file from rapt, This optior allow* 
you o -cload a previoLsly saved filL- frorr 
tap*. It will prompt fir the lO-craracter 
filencfne that the file wtA sivci under, Vou 
should use the header catahgue fjnetion tc 
find th« exact fdenane if ytw cannot 
remember i . The specif.ed header will then 
bt loaded. 

If tat Hit is locked jcu will heve :o 3top the 
ta>e and en;er the correct IG-leitcr password 
be for: the program will load the test of the 
file. Unprotected fics will load ;tra.ght 
through wiihon stopping. 

1 1) Save file onto tipc. T.iic apitonulluw-Mht- 

curreic file to be savec on tape. It prompts for 
a 10-character lllettanu unde' which the fi.e is 
it j be saved The pre gram :he:i asks if you 
want to restrict access to the file. If yoj press 
**Y" then you will b: prompted for a 
lC*character password which wJI secure that 
file. When you have entered this, «r if ^ou 
choose to have an unprotected file, the pro- 
^rim will display ihe nessage "Rerdy tape & 
pniKK anj key". 

Vou should set us the recortiet and start the 
tape leccrditig before pressing a key. The file 
saves in twr bursts with about a two second 
^ap between them. The file is saved in ;. coded 

form. After : -svin jt the program -will jsk j'Ou Cu 

rewind the tape and press V when ready, the 
fiL will then be verified. A successful tfirifica- 
tien ii indicated by a :etLrn to ihe menu. An 
unsuccessful verification will dtspky the 
message "Tftpt r«OTtry error". Rewind and 
try again. 

12) Tag field sort, This function softs the 
items in the file into alphabet.cal order by 
their :ag Gelds, 

l'J)Vew item, Thio eption will prompl for 

the key field of the item io be disp&yed, md 
will show the whole itcrr> or. the screen if it 

CJi.S(S 

14} Wipe file. This option is queried and if ex* 

ecuted w;ll -wipe the current fit, remro.ngiln; 
internal pointers to thrir orifiinBl positiotivB 



(continued tron: pegu 102} 



. . :.■ 
l Li =.- 

=;; 

32£ ■.* 

..i 

<■■::'. 

e=:n 

61 -J-,., 
_ . .- 

. a 40 o 

£31 US 
i ~4- :f 

* ." I : 

... 

till*. 

5i.i.: 
.. ■ . 

- -•- -(■ 
g£f5Z 

«a*ft 

taeu 
.. i,.- 

taeao 

£2cV4t) 



-f. r >«»i?f5£;i.,; • 
oo^ee.BTCi^eor." 

<i s*!*m. j j voi 32ir :■ 

IMOSvl. +J13Z7F 
01Pei»^J13D025C) 

oil^l'i; : '££?»=.",■ 

..U'. J-FE1S2!TS 

: l-v^u,l, _ _ ±ch. r-- 

. -i;ei'"£:oL-.-fljg 

. t ■ J l ,JF F j ^ ." . n Si [■ 

:seai«t:e.3tBoii* 

CD3S01*0:BD:56ei 

isiotrrrTosrciu 
aeesF;oF;gc-FEui 

3SC6i«tSCt>»*&BDt> 

^E0iFf0«5=-: 

0SFc«e:gf JFEM35 

iFCD3Iii:.-S*rD9f 

fetd,. - ..:cE77flj 

■ei'. :^L"-03eeiai 
1.'.. • , - = .:::;,* 

.■o: ,.o. -cr^r".-' 
c-sje&'aiTiscQiao 

: C' 856 S C C- C 5 " ilr E 

. f : : e .- .' , rrx 

SSieO*C:-?S?.-jC311 

6Rcr>«^*,-'"r.F:69c; 



07aBHCTflFL-. rf) ; 
3«*FFWS5ei»E-F 

Fr,ti^iHi: - iii£3BL" 
a£>3i£FBii9-ieec)i 

0Daifti*FCC-3t2&=- 

«»: 3HHSI01II3U 



B .-0 
1 139 

tie 

ITS 

fill 
BS 
Df4 
lOxf 

I." 

sat 

---- 

aea 

#5* 

-** 

:ii ■ 
eas 

BIS 
i: ■: 

i; .-. 

88* 

731 

::i9 

1317 

Ill 

J -rr 

61.. 

■-■: 

Alt 

M 
*ii 

'9S 
fiTl 



BiSH? 

MUi 

es?ee 

4i?6e 

-... ■:- 

8£00i 

sfsie 
■; .- .'. 

Oi -■-£ 
8SB4r? 

a;* 9? 
- ; 9 o - 

sane 

bi*3i 
■ I ! 

Siftes 

.. V. . 

|S97« 

*:.* :^ 

z : : .. - 
. . ? . . 

SHtf 
BIQEf 
61(364 
•'14 73 
.. O .' 

63069 
I JO« 



j- ^;;:iH03ii6 
i,iaii340L»oi«oe 

i~i?£"iDi:L;j^i6f; 

i^-.. , 6F6C341ft80«3 
i-.UiiCiiaOiiCftF 

;*#ie&54E5F75erijs 

^Oi.'CHilSJtpJUiO 
lbSHH>CS44834:baO 
ITlaOiiMftTBEOifl 

cnaaiuHa'.i73«s 

fi«7t»F7310?J ^57 2 

e E2 o:- F £ i ^ nL- i^F 4 E 

£9i«s( , L£eai?op:^ 

■li_ ti I t^J "J "Sf ''--10 
eE6ET9^A^ -I6E6C 

eiiaacij^ofiioojii 

Z ?Ot"i 1 3 31 i. 9»5 716 E 

isbc«4£0frFee,aj8,« 

MiiOiM: jo 13391 
lO^^:. ;. i i^"J9fi^ 
l< <-, , -iv_»Vj.'- . 
l30JiiO3S3iiaLft 

«««7tf;8MiCu: 

4J : £-9fl,l€C9?4i*r T 1 -'^ 



6DlSSi03i57!~t72 

nsTartiBo^a '-t€f 

614+*ST.:0*J*1,7j. 

03^B497ieE<9l>5»l>B 

090 SiC * f - J-iiSlj * 
T4«9Sl>73 ISJflBJSf 

■*:•&* f r*« rri: j ?4 

JTPfl7S78:frSiO^E6= 

77 ifSSe^S 1-98971 
16^.. i .IfF- ; 

6816358393817**.? 
»68SBe:99i07L«F 

aC7<i81739916QEa3 
&ielS7a>888«656C 

*u.pn* j »*»-aTt.Ls:!,F 
flasejsftr"-3jos7i 



1S2 


sats J 


-f ^ 


-.':•• •■■ 


S6 


Hlli 


IGA 


53192 


Vl--- 


■ -*i*fl 


1*7 


ssite 


1-77 


S3176 


24F 


1 


f*4 




~-cL 


. ..n.- 


d59 


iiiOl 


tea 


isnt 


36tf 


■■ 


iHJ 


iszsz 


R s 


s ^rifv 


Jill* 


310 


93386 


ran 


53161 


i-<,- 


i :-r-* 


ii* 


htli? 


:o . 




77' 


.-.'■• 


17S 


53312 


ii 


SSSfS 


Wl 


13331 


1 38 


- ' -4 




*.J355 


ffi 


iiiii 


:: t 


»33"'6 


kfi 


6334J. 


1-1* 


633«i 


Ei? 


: ,V 


■ : o 


l -it. 


Ef9 


. '. .. 


TfJjJ 


1 K« 


H : 


534,32 


"56 


..:-j 


flor 


'ji<-a 


M? 


53if* 


'Li 


■ 1(1 


56 1 


43173 


55* 


•• 166 


oo: 


"--•_- 


,-. 


63^96 


U7A 


63501 


C -E 


63S12 


MM 


1 . 999 


H »:, 


C394« 


E. . 


53836 


M7 


53811 


-i~ 


536*2 


MS 


53S68 


i-: 


i]IH 


►*- 


*367S 



o5<3DJ*l^ftDE7e*TO i 
c3;jf?d r t ,1511 
*"-:■? '- . 656986 

f:t-- . ±-*:-:- 
■ ■ .?sft*i?. 

■ - i'.'. .._ "Jjh : - , 

t '■_ _ £C _ J. 3 Olr ■ r 

. ~t£?FEO^aret.i? 

45S:BCe8?330J iiS 

et.3Q.iiUSBiStl8 
43."J.:^i1-'iJ.S5ll5 

iic _ i3i:o,ieji3ei 

lJD74Bi6:--liti?~13 
iE75*4S;;i*. Itri330 

io« ;■..-«-. :m:»; 
jsts -\ rsi(jsa5*»2 

705-E1501S£SJ7?<*? 
73755}5;S23JZCi7l 

6FSi3726*f :t*J?fl*6 
65*lE-r.F72ie063O 

o! -■'■pae: 45696 iec, 
6? 'flioa*;M!i»>c«- 
i.:eF* :ef 6B=■iiJL , ^ 

LStBlZSlLC*'. ,l 1 

^iT65£07'^- J - 

65-i79ih3c.i .'-.■J6» 

i§^S.i?«lei^i 

BC636E6L6&6Ea066 

si'Tiaeeiii-i*:;.' 
.^.-llfe'gJiBSeCC io 

6 37i2>fl*Jft36173 
65.-i33' ; .--iT«BS2FlE 

29icso; : >c:isecB0 
. m u i . iv-sse 'ibL, 

i;7ci5:^." i :3776F7s 

S*C ABC l«tf 8130116 

^•^ciJK.i-iJceflaes 

: .; - ., ie..(!K 
90163(70-2657373 
-0tl6E70±eB6e873 

ioc^ieiafaieeaia 

CiE26? _ ^F4ftir6lA!l 
207iJ~."r ^.r- - 32022 

56.-.->its:5ee7i6Fa3 

Ee4?!,-'taiBB;i3«U 

iaacijiD:i"03a»3ie8i 

4F.-J-7,»i:.77**BC«» 
BCS«6*F 1 je65B04F 



E 


= ji r 


- . . 1 


6ta;*i- : ri6i£06« 


■ 


671 


1 


g« 


. . j?£ 


6Cf>F(306£e' F 4crse 


« 


"1* 


1 


^s: 


.:?-,- 


-.>!=? 1 V BC 3 rtie^ 65 


■ 


-1 


1 


T4? 


C2SS* 


«j.;ai2-oii904;i-e* 


s 


»e 


■ 


-tc: 


S251f 


floiJ*Jtiio;.sojr3 


_ 


i» : 


I 


»4- 


- " = . 


SlJ.F?fl2f5 4 -iriO 


a 


|3S 


I 


_-f_ 


t?3S3,J 


*jni;s*jiO(?jijOO 


= 


T33 


1 


3*7 


C3S4jO 


r i' ' t ; - - ~ " 


o 


152 


■ 


6i: 


J 3 JIB: 


ICti "•■ ■ '. lo?^"" 


■ 


;ae 


m 


LTi 


riiEi 


2 f ' cm _ _ ■;T-= r -.' 


■ 


CIS 


* 


J7| 


f :=£ : 


61i(J*5C5F63SB«J61 


■ 


7SJ 




i -' 


53E7« 


2iODioe:4-EeE7 i ft? 


± 


17i 


: 


a= 


; _■ . . 


.. l ■4±. 1 5F.\'...,f i 


z 


.' 


t 


-?=!"■ 




■J-j"fF-ic4 iflu 


■ 


"51 


■ 


?; 


, :, 


.ilipaoi; .'..'.., i ■ -; 


* 


L. 


I 


St2 


'.... ?0 i 


IftOi.fCJ.jLSlE-lOt- 


I 




: 


L41 


63?1J 


■S-SiiSilJ^iieFCil . 


1 


851 


: 


r :: 


63722 


S353574FfJe*4ir,74 




E43 


: 


7B3. 


f -. 


-i-9*»>6l6--. teflBE 


2 


?^i* 


1 


■ T% 


e.ir-nv 


1 .-OUt lev <!-' 1 1 JOJ 


■ 


:a 


1 


irl!" 


«3,7*.X' 


84001 7C4are^F 7665 


= 


:tT 


: 


L-^, 


43?*S2. 


7J"*£t; *t^t JJC- ' ' 7 


| 


"8t 


i 


tS4E 


*s;6e 


es^ioir-SBei^:- * 


■ 


T95 


■ 


™ 


e?:E: 


- ~ j ^ . . 


B 


6s: 


a 




61"f 


■i ■ .z,ct 1 JO.-'i '..ii -, 


~ 


:i 




■5 1.7 


e . 


i3Bes3er.?i?6i 


fi 




n 


_ : ~ ? 


L' . ' -^ fc 


-"BF'JIfl-" 


* 




- 


7 - 


■ . :,' 


6870-16, 5*1*:0D1- 


m 


ei: 


■ 


aa* 


63 tee 


OMO-tfl. 1 11*13«V 


s 


71 


* 


- -. 


ma 


5391- 1B."»51 J^H14. , 
aS?0*)il. , 5Cl4FiJL' ' 


m 


51* 


1 


^*g 


* 


123 


| 


y#u 


= : i : ; 


:iOO: ai; 162-ao*: j 


- 


78 


i 


6-» 


ft a ue 


il.*S?£^-e57Ji^ -L 


■ 


S5fl 


= 


eao 


53E45 


4 ,67S66ie&d t^ J.3C 


S 


7*# 


4 


L. 


nm 


*;««?■; ^saasF 


Z 
B 


677 


= 


■- 


%ifi 


:-: ' ,--:E6=-i 


■ 


-.•? 


»■ 


721 


f:?s^ 


illtifi ; "f l C "Z746-J 


* 


79* 


1 


i. W 


63865 


'. L i ."JU^lISBClf 


B 


312 


■ 


j _: 


63 i yz 


J1^0DJ65517J6;*8 
UVi.E6720=5fF ■, ,, 


I 


m 


: 


431 


i-.yiJ-, 


e 


■ 


r S 


£3 Vim 


iaeSACC3C5C6C7C6 


9 


u :_ 


= 


a is 


63128 


C<»CBi' V.fEZ-E5C7B 


i 




V 


23i 


f :■•'.-- 


Tr.^fiii. 1 - c ?BEi7Ce*j 


i 


BH 


1 
■ 


."' M 

77S 


6 - 1 j g 


iJ4:.44J.EJ-S431t5* 
■.. IL^E7545£E-' J -Vi: 


■ 
■ 


Us 


| 


es> 


e:o!j 


5t53416:iCc4liP6i 


■ 


94 " 


4 


-2: 


63.960 


6iBliE64Tr;, L ...^F6S 


B 


73 ^ 


= 


QS 


63466 


5795:66E6"[::.EE i ; J ' 


■ 


we 


P 
r 


65J 


f " ? "' : 

D'JVBl 


OaBBflF?!'*!!-!*!-! 

yi -iv .o.uicfloeeo 


w 


Is 


I 


&=E 


53*9H. 


j. i:i>3J35:3S373A 


1 


12C 


P 


131 


; Wl* 


3 J 531 3 3-I35Z637J! ,1 


1 


Hi 


■ 


i ' 


84H8: 


3i30:53;3S;7.l*^ti 


■ 


481 


■ 


71 


64-616 


31 3 31 2 3 3 E 556SF5I ~ 


■ 


59 E 


3 


7*3 


04.4*4. 


j .-..--.- j ■.;!' -. .,, l.. 


■ 


io. 


= 


76 "■ 


B463J 


Bifleteee * i 







104 YOLR COMPUTER. MARCH 1 38& 



DISC OVERLAYS 



Thh BBC covin' ru? is, a sophisica ed 
machine will many facilities inr ml nj an sx- 
ccllen: Basic interpreter which sets it apart 
from most o:hei home coup iters. The main 
limitation ofiht machine is the restriction el 
having only 32 K of Run. Cassette-bated 
machines have about 27K hyttti *milabl« to 
Basic when using Mode 7, but disc-based 
machines have only 25K because the Disc Fil- 
ing System — DFS — clai us abmr 2,7>tv lor 
workspace. Using any en her screen mode 
rccuces this sven further. 

Very little can be dcoc to help thv casserte- 
ha>cd awner, bu: it is possible far a BBC com- 
puter with disc irivc to run a Basic program 
whose size i* limited c-nly by the capacity of 
the flflppy disc rjeinc used and the «titl of .he 
programmer. The way to achieve rhis ap- 
parently impossible la<k is ta split the pro- 
gram intc a nunihtT cf separate modules — 







&FFFF 
seooc 

HM=M 

LQIVEM 
TOP 

S19QQFAGE 
£0000 

for a typica' 




ROM 


SCREEN 


VARIABLES 


BASIC 
t'HUUHAVl 


WORKSPACE 


f 


'igure T. Menory map 
ia sic prcgr&m. 



P Andrews squeezes 
more into the BBC. 

which tvery programmer should d> any way — 
;nd store thejn on a floppy disc, 

Thr separate mnJjJA ars only Loaded in 10 

memory when required and so tie modules 
not being used do not occupy any smrc Ram. 
An irei 0. Rim is set as id; for tie program 
modules to occupy when (hey arc eallec and 
baded frnm cisc. T.lit arci ir known <i> thv 
rverhy area, and the module, i to be leaded 
from d.sc to [his urea are known as overlay 
nodules. The term overlay is used because 
when a mcdule is called it is * 'overlaid** onto 
the overlay »rea overwriting any module 
previously ea ltd < 

Fkcnuse moduli. 5 will overwrite each other a 
control section is .equird to ensure that 




overlay modules arc leaded whenever tiey are 
requited. A luutiue cullet! tlv.' overlay handler 
is used to control the loading of overlay 
modules 

As weE a? the overlay handtcr a section of 
code will rJwayi he present in Ram. Tr.is con- 
stitutct lie main pru^iain and will contain the 
rmin body of me program tnd any routines 
which arc frequently called, It is unwise — 
ur.lcss absolutely Decenary — to put frequem- 
ly called routines ino art overlay since the 
jjj.jgiuii will be 5i-jwtd down by the routine 
being loaded from disc many times over. 

Figjre 1 shows the memory map for a 
typicd Jtasi; program. Figure 2 shows the 
memory mai for an overlaid Basic program. 
Since I,oratra lUcUcttlQ 10 the interpreter 
where all identifiers arc in be stored then the 
ovcrlsy area can he created by moving Loroem 
to make mom for ".he overlay mod alci to be 







APFFF 

isooo 

HIIVEW 
LOMEM 

£0030 

for an overlaid 




ROM 


SCREEN 


VARIABLES 


Os/ERLAY 
AREA 


3AS1C 
PROGRAM 


WORKSPACE 


Figure 2. WeTiory nap 
Basic program. 



Listing 1. 



MUTH iv P. hirn nn' i i«U. 

Stir r*OC<4!H> Hl» **»'-H.«MrCMftl~ 1 lBtir- 

4JnW fhpunc. Here ■ p i"«F**"-+i , «»^' ■ *T - s EHfc.. EH* 

Ml 

m4f1 wi tm »H* if w^»Ut mrwm r 

Ml 

WV-I : H 
1*1 

I ItAtttl fcM-t w WW 1Bf*IfU-1 nM nwflif "■"* 
13*1 

lMm?L.J»CH-2 
IHl 

I Ml 

l7tvGn£^-L m pifih 

ion 

lWmcit»ll*jnr|«iJ<ii>«' 



j*n 

HtmiJ' un-aa.ll .5t r !r,.».J.Ifclt 
MA 

nn 

!Wllk' *lt«I 

imno/r rwiwf •— twm ip~™tF.in»— 

--•r.-L-. HW .«"i is! m>* :•" »*» ^*<ft« ■ 

mv 

330 



■ Li I4kbi I ^1 arl ,f*d|4i)|rl 

fcMfrl W Imi'itw-IJ/y 

HVTP ->^ I ■ "' - ■ TB _— ! »T f . .t™. 

— liBUM .>rNr:il m l.l ^. •»•!,». pn 

l.»i « I 



r h. I««k| »^ 14 . r .VL'jl ■ r »L l l>. ■ 
- iV 

T*IM^M > -.t-iai-..- 

Hunt 



itr L j»^ I- 1 , -3 , y, ** t 

fr«"«jqC».F»r™r!»;; I . (If, . T-I. *. L .». 

rA#it. T k.l3..i-.J.jyt..tW1 . -3C 



I WW . i.T.m|.r M 
•WPqi Ml Id .;-ji »1x»* '-• 

"«»IJIT-*i(fE»E*T- UH'L !!«»• 
4l«tH 1.1 



I21HI Ihalf. kuile nilo« 
ll^WJ H - — ■ ■ ■! 11 iipjinmr— ««- 

l2fiBW Pl«4 J Fit *J »l I f *_o. rr ■ *T„*»^( •» 

I TH*».ik _|.4g( > If 1 r uot - j^tAi ^!4JW«^%ll«4r .ifcfl 11 '' 

is.rnrp WCp^i 1 .S.rj^ nn: MU^npvt 
LjTltiv Lti^iOv.lwitfh'iflt 

LSJBtMtHWC 

1 -^ Vn^^FXlfil «W ; L nv ril [ f ,nv nn! 

l^Hir ^nirfLi^ lu Lu^J ■■■'llri 

iI'fc^F t ^,4 ,prl* 

mi' «r »♦->-«- _»»»l -HE" «W ?.»."• njTD IdW 

i:*»ir «irjtp4 ut ^Miaa k»H mm 'l ■}««•. irrr I 

L4Hnf . I«a-^_1| ■ * I 

l^;#|f'rjW f]K>M.H iHth -|»T| Mi/WW».^,*«. 

ii!rriK>iM)VF(il.i.i«.t i.i.twjni 

ILJIIH- |... .IJIK 

I >'4tav .Pi**IT- h nW K il<.-D»_r.^ 

HS»lf lt.m_uw»i'_i™ T«^ HPI 

l*<flBB' Ifip mFln linl »« liufcl InHF »tar T - 

L*.«? , FTEiWV«TF'LrFfl l4,2ii*F J »t¥ _p-s **V?n-**STRf r^ r*| I 

l*H»«E*«l.l»«»»nH-LBFW ovw ■*»! Ml I «_fuif F- ■*[S'Ml t 



*INT 4< f 1LWL > ■ 'V, - 1 IITII »,UF«]HT»I 
■ L.f-HL^ -■ 

CF.*l n lt*I^Bii.»lF«F;5*| LI , 

fTflMOCniE L M.19 1 ■ f r9* *}W 1 iH + 231 1 

cm. e.i 



AlWlfn inl ProLttfuri 4#ti n».T iv>i- 



mUCirrH^ -1iii»1*f 

l«KlCF«:tin*lidS« MH.mu.^lli 

li^wcFvrtinaiima ■«.«",•<*' 

4 L 3 - Jl ■ »■ - Fn- . « ' - ^n ..j^f . 1 . Vim I 

• TS'me.o.liPuilaUH J,"l,^i.l, 

■wixi Ktiiice.m.:. •»»» 

.'■ilfllplt.it, 'f^WII 

JL I l{U ■•, -ft ."MJJMI 

41 I I^B4 ■ t'W L H V l F J ^».lBri* 
■.J+T TMir.ft'nFj CrVl Iv A«ll' 
<IM* Tj.] iij.i-[ 

■ !H" T«iia*,;)i -im nl» 

F^yiF^ll" FH-F IM.I 5' "'■&F' L 

limili rji»(33,kli"i H i*Wi' 

MmiN 1 pi h js . in 1 -*, ' I "r«F 

■ In- rnl-ii.Ji 1 ■•"•J ' 
Mm" l«(il,l>'^ i" W"C« 

IfUlF." TJlf 135. |l 1«IT 

«W»IH - U|iL,lV«,<<l« MltlPt' 

i'i»-)F(Fi' «.-.[ ,•>,-; -em' 

•atFltpn imai*j) -tvhh ■iti»ii.i»f-im: ij* 

mnrjm-ciiw.17 itKnnnpiiniFFMiKMi 

*J*T(m H-r,n»«l 1 1 7 *Etf *(»mrH». HTMHHlL! 1 ! 




tHMCF nnvvrt.mt.lH 

IHUXH r>nl*l,r.f<]., ..kichh 

LtHBnitN'! iimi,' ima. "I'taia 
natwcnnr 

Li 



l<Hn«M MB- 1 1 .Tfc.S, 11 , 1 ♦*,*■*. M> 
iLf*» "I-f" rMra_^n iIb't jn_.iMlf i~ 

I r,r* c, ftDC-i n»F»- IF. il , IV . i**. n , I . 1i"1 * 

"-VBIF Vlr>. tF*,+, rriM VM I "Ml* I Af _t, ill * P tL9£ ,fHV 
AJ ■ , ™ r -flv_t*S LI I 

LtJp»Tltt.iniB.U,2.,12, LKn< , •• , I , li , IMF ! 

LKfcr* m.-w,<*-l 

LT>»p¥fIf| Pill ID LDWl EfVIvLA^" 1 

i!inr wj-i»«t74i».iilp-1Jii« .<n ThW 1*JP 

L^IMhi 4Jl^*#^ w fm%\ ""lo^pd- J 

ii-*l( I hi •j^wwnH ikfil tut. <iv>*'.Km''lvJi4<|iil 

DTDU1K **■ iPlym Ipx-pirX. 
IWiMfrl B1V4 1m ImmM nrp.baii «^p* l* T . 

(Irloa n,3s,f -Mtlt j»» . *l>*p-.irnii 1 1 nn. 



•II 



L»>P'*II" "TVPM I-' 
LHVRIsT Til rilMt td riLl h^» 4MWH*Btr#t*ffTFi. ^ ' 
IVHrnnfr ^|A,ik pr 2ft t.b ni,pi' Amt^r r-mTLiM* 
IIMi HW '■r.rT 

lllfpni 'Bp.r'-"!* 1 ' Hi rp<Flv*--ir w f ntlyf « " n»" ' 
» rtBI»l=— 
||M f .— 1,1 r<M ||T« 

lL»>.«l^ y n.^w-^r V«^ IK (It IF V ! ,,<,■.■>] 

1 i^arPiKiM -r —1 la*— <-*.| »»-- 1 '-Bool "-1 * #>n *y_n>*. 

p ' 

I HWmiFlT H|ljFF h - Flfc,^ |F«,LI| 

it*>MIIVr " rPlurn +' 8 » »,„1., til I ' 
.1MWTIL. F.n ,*.- 

L|MW*4t 

, 3F»flt*r-«TC"l FFFH-K. L f |l|4 S- Ft. F.U.l r .r _* fe A^ 

iifcHi B|>l vl.»».vT 

riacOLBui 1 

.-■*.:». cm i.».se 

^**m f- 1 +**- J 1 *(J IipC* CE.V 



1 ianii^« .esMiAnj t uou uw*- ■ 1 ■51m 1 mvv j»i» 

iF,win:«H L iui.i"i i.i'if.<',".l, *» I 
^^,m!' .rrl TfCM vnl Ilst — »r 

1 ^,SlWTl***-FF ■ . *l— »««—■ — * ! — - - — 

]fciflBtF*h"ii4w_r*l L*i«iv_ncl 

1 * t1-*W» Ifim.ii; nNIrf.(_iil 

iMnwiad ih^ii 1 «i« ™> 

1 T^^^H- - .^. -■ ■ — — — - M FIMF- FH"F 

irtf«»**eCiH«» ipin.pjFf^^ei 

ITm.tfJC 1 

IfHifmiiVim.Lv ..I |pv.cr»„. B l 



-•till 



■ T*l 

I TFTCMp^fW-^Lr _ r paMtafcr d r L ip#* prt i i j 
L'nptinr'^i. ta uhi»Fp -i.r*? 

L 7ill*PlMPkCP • CMRinEl 
IIHItQUIT- HC1 351 
IHlHnj,iiH«t' BJV TU 

■ TTK-Jtl (*!»? 

■II 



»36 VOUH COMPUTE R, MARCH 1»5 



Iu;ii ,ed from disc. Although [he o\crlay 
scheme can safe ihe spate cccupied by a Basic 
program n cannoi eisity be used tu save the 
ipace used by variable*,. 

Yjtch (ivtrlsy module may ;ontain several 
separat:: routines. Ta use r.ny of "he routines 
the overlay module in which they are cofltain- 
ed muit tic prc!*:rii in store. If [he module 
Tins; he continually loadec this will be slow: 
cnnvcncly if already loaded then access will 
dc ast The program will run fauei if those 
routine* which are called in stuuenc-e are put 
•D(0 [h? stmc module v/hcievei j.cbsibk. 

In BBC Bade two lypes of overlay rculi.ic 
ire possible — 1 unctions ar.d r:rocedi.res, "I Vie 
overlay handler mii«[ intercept lun a ion and 
procedure calls to cerliy routines iti order to 
"nsureihai the correct module is loaded Abo 
the handler must know which overlay module 
contains tie tourine heinti called. 

To oisc re that th; modules arc loided cor- 
rcc ly all i verby routines rnusl be accessed via 
the overlay handle:. The handle! iulb iJic 
routines ence loaded by using the Fval func- 
tion. To mate this passible the call to an 
overlay routine i- made by eal.inf the handier 
with El string as i parameter containing a Oil! 
to :he routine, A sccor.d parameter gives ilic 
number »l he mrjdule within whic.1 the 



routine is stored. Overlcy medufes arc 
lumbered ^tenliall) staTtn^ from one and 
are tept on dis* in a terjes of Ua^k tiles 
Cverl, Over2 and so on. 

Three separate rojtir.es are p'ovded to 
alow overlay routines to be tailed. Each 
routine ensures thai ihe correct overlay 
mud jIi; is tit emit in sio j t bcfiinc. ihe nvirluj- 
romine is actually called. The siring 
parameter contam.ngihe roalinc all reec not 
normally contain he FN or Proc keywords. 

Hot procedures us*: PROOi ("iht text c:f 
jiiLMi^dufc till" orcrliy module number). For 
example: 
FHUCo ("initialise routine". 1] 

her numerical functions use FNo ("text of 
fiiTutitir. call", overlay nodule number), Foi 
citaiLipk, 
LET sum = FNo rtli.Torsnce{a-6)",2) 

Fee string functions u*e FNs ("test of liinc- 
ton tall", overlay module number). Fcr 
example: 

LET )t$-x$+~N9 "'siring function 
{" "BBC" ' )",2) 

Beeae.se the handle: calls the overlay 
routines using Evat .[ is net possible to code 
procedures in the normal way. Wheru an 

k.:vciliJV luuLiut ii u^Til ,,*. .1 procedure ihcJi 

' Def Proc" should te repktcd by "Def R^' 



Listing 2, 



»**■ <>**«i«. 


mtmm L. 


•jfXVH 


*■.,,, 


"■1" 


" ■'■ ' "■ 


ftmml 'kit»,li 









III 



immtt tHrtul ln> 14l.»> 

T i ) *.«*■ nwlyl. urlT 1*|_'HI^~- 

B**iWJiff IILWi- n-|*>;l|' r.ll — <r«P -,lll*.|* 

HfKII 

HMmm 

GLIdPH*' *ffETU**i lotfmil Bttfl i^itLii rLLtlnfli 0*" 
ILMPPHf *■ A, Iff «r ?fi r.H pntp«- *MltM 'LuljriI H 

Mtlir 'wiii"- Tht-H r;i-a 

--:<a~**.- L*v.hirftH^^r'^H rp ] bi * Hiilf ♦ . I ii 

■ . ■ 1 1 ■ 
^HB?«:tn I nBti' IA -t4*tl*r return ir~ -vn«r <M 

11' 
»l^4H*>ltL- >t»l(1-" 



irV£.n m .i i ■ ■ . . .-.■-- 1 - - i . A . ■ ,. 

17.HRI ■ ■ »WI" H 1 I J I KII B 

■ Pl«»,|pnp.ili..|. 

WTUL »*pKy*l ->"l*. .^nff*»^ 

i:-»inj|<i - ihmi, ill 'rhtii- iiiIh If.M -illLH,. 
>ii»« 
•;uh p. Al 

Hk<r n rvn* i— ' 
p«[wt wiumdwi thu win fhIih. »■' 
SJkWnC^T "IA.1E ff ?• " xtlpr iwlhir ruitlrB" 

iJiiinnjT ., n .i >■ 

33IBjfl _ [L -ivi I ;l-"\n- ns rpplyf'ib' Bfl rifilT^'W O 



h-iuBlh r^ilff-" lltll ■.■..■„■* 



i.ii-Fr ^LVHJ. MJIJ* ■■ lv.i ■ , i ■ I ■ 



tiMm*lU2a I ' uul.iii.- - *t LviLp**" ■■■'PftiT Inpll- - I'^vmlir, 
J«*' ■ 

j'-Uif>.D,T fLsail" 11 '|<l)lt| u ratKfl <•— imr Li T c* 
11 " 

3iivi<iit f*»i-" 

Wt*W7" r**1 «rp^ IHH ■■» .4^*.t n^ 



and "Endpioc" should be replaced by " = T> , 
Any paiaffTiEters c:jn be passed t3 the overlay 
routin-zs hut CMS b required for stri»p; con- 
stants. Because a nriRS cnnslitnt ma LjLiti.es 
any siring parameter passed to the overfay 
rovtin.- musl have tile ijuiitc Lltiir.iLlLTS put in 
pairs otherwise they will be taken as beLig the 
end of the sirinj- For example it suing Tuiie- 
liai I'ortaallv called using *FNroutin^("str- 
\as"Y when noi using overlays might te call- 
ed usir.g the overlay manigtr as 
'FNSo{"routine(" * sirng" T\ I'. 

MdMi iherlay routine calk involve unly a 

single function and mi rather than s apply I he 
"bN 11 keyword as the firu tharacters in the 
parameter string the overlay manager will in- 
sert the* before calling the Eval function. 
This Mvca iwn \-yiai jkf etll. If ttiitcond ftinc- 
tion is to be cal ed at the same lime then he 
FN keywords musi be added to the funcnon 
name. If the function s overlaid a rested call 
to the overlay handler is necessary, i-or exam- 
ple function fu no I'xi'.t , in nvcrbv I and func- 
tion runt esisis in overlay % ftnc and rind 
art in the Rcot. An overla.d fa net ion coll with 
both functions cuuid be laade with: 
10 LET X=func+ FNo( funa + 2'FNo 
t NN funb , ■ ",2) + FNfund-',1) 

listing 1 umlauts a demonstration root ind 
ovcrky handler I.isiings 2 and 3 contain the 
code tor overlay modules 1 and 2 type in 
each listing and save each program as "Root", 
"Over!" anil H 0ve*2" repsectively. Th*. 
demonstration shows on the screen the 
loading ef Q/erlay modules frorr disc and the 
rirtted calU bciuj processed, To run the 
demonstration type Quia ,f 3oct". 

tixeminc ;hu d^jiiou straiten li*tiig WV-n 
you are familiar with i:s o pent ion y,»u can use 
list JnS * *h»ch is ike over. lay handler t<i be in- 
corpcraled in your ovn programs The 
handler in ihe denmnsi ration should not be 



Listing 3 



r + U..II;-, 



531BREH Ovari«r »'e« 2. 
na?«RFn -r out i n#2 A 

D3 3BRI?r1 

504HDEF FNrouttriB2A(s*: 
SBSBi OCftL rtpl v*,ovBrl *y_TLiirbwr 
SBAUPfcJNi ' 4ib0*i" 'fi •■f^h\t ; * ratted -from 
*;f Bbl* 
5B7flnEPEAT 
jBH^RFPEflT 
5B9apR;rJl "Typ* =-" 
51B0PR;nt "RbTUftN te «x i t thi^ uv«rlay routine, or* 

riliaPR:NT H l(L,:Bof ?fl tn enttf another r^Mitine" 



51 20 INPUT raply* 

51SBUHTI. rrpl/*-"JA" OR r^l T «- ' 19" BK r«ply-*B*SA" n 

S14BIF rB P ly*="'' THEN StBfl 
■H^Pln^nr-lnV-rn^be^-EVAL tMID*{r»pl¥*, 1 ,1> " 

SltBPfiOCD ( ,, ^□utinE■"+^•plv*+' , t " H r outioetA "■) - , ov»rl*y_ 
number I 

Lil /HPRTNT 41bO*; a 2A ';fBblt-;' return friim overlay C* 
Jl" 

SlfBUHTIL TEpIy*=-- 

^IVHRFfl exit fron ever Id/ routine 

gq»ui"U 

',>'.' linHtn = = - = End of Ever Lay area, 2 
> 



listing 4. 

[flKEn BEC Ovirld/ Handler Oemorntr Jtinn 
20REK by P. Andrews April i'/O* . 
30 IF s AEe<>a«i9tS« THEW PflQE^Vl^BeiCHAIhl'RaOT" 
^eON ERFOR 1-iaDE. 7:BErORT;PRrNT " flT ",EPi'_.rWD 

^H*Of-r 1,0 
Mi 

7BREH stt up sue of ivsrl *y tru. 

ye: 

IMBh 

IlBREFH s»t up pointer to start u* ovar:*y irea. 

;3«QjC=LQKeH-2 

iSfl^Er* r*nr**r space- for overljy arva. 

IUl 

lTB-LTt-EJULOhCm CX 

IB0( 

L ?0=Ra:i ni tiall M_Overl *y _handl er 

7flHr 

22B: 



Z3BPROC5creien_displiiy 
NM 

^tiBPRnt^ . r..1..« (Jl , i 1 , A9,?h .0,5. TRUE ) 

26Bt 

:7ff>nOCpont_reut:ne 

2803 

Z90PR1NT flbB* 

JW&VDU7: PRINT " — End c* deiwjftstratimi — " 

J10PR1NT "(use CHAIN not RLN to try agair). 

32OST0P 

sail 

348REH" ■ ■«■»■■ ■ ■ ■■■»■ ■ ■ imniuu 
358R£H Root Procedure De-' ini t ions . 

37eDEF PROtscreeoai spt *v 

3BBVDU 17,e,4;0; 

S^BPRQCr «rc t anql e (73B, ZHB r BB3 , Z5B' 

IBttPFWCr- »c t anql 0(750 , ABU , 3H?I . 7flB i 
11PPR0CrectanciJet7aO,:HO r l ,?B(fl 
A VVmilCrec tanfl 1 ef 1 BO ,6B0 ,253 , 1 > 
43BiPR0Cr?c tanij 1 t-t IBB , ABB , ZSB , 1 r 
44GPftOCr ?c tanql ef 32, 415 , 1 , *ci«t 

flstmg 4 continued on next page* 



VOUP COMPUTER,, UAF1CH tMS 1[7 



1 Vst 'Inj 4 cnntlmtfiff tmm /imwoits page) 

4S«PRX:rect anal* tB, 975 , 1 , 6»Sl 
460PfOCe] 1 >p->- (», -P I , 252, 6BB> 
4/UFRjCel 1 ip-ii' t?*P) ,0.253, £58: 
49BPR1NT TftB (B,B> "Max cwlay nest** 
49BPRINT TAB (10,13) '«" 

SSarRINT TA(l(!4,Z)i"Vir HCtles" 
5* SPRINT TAB {26, 10) "Refit " 
32SPRINT TAB 1 33 » 12) "TOP*' 
539PRINT TAR < !W » I 1 1 " lc* i -*TOP 
34BPfttNT TAB(35,Z0)"f;^PAG£ 
53BPRINT TAB (33,21 » "PAGE' 
S6«PRINT TAB (35,1) "*"1~L0«B1 
37gPR(NT T£B(3S,2) "UMBJf* 
SSflPRtNT TAB (1,151 "Overlay netting" 
3TOPRIN1 TAB<3,5i "Di me" 

i,BBFR!NT T^(4,Hi "QVEPJ "t I f*> 1 1 , 10> ■'0WER2" 

6 1 B f 1 nO* LHK» ,17i *CHR1 C 1 ' *CHR1 ( 1 7 > *CHR* ( 126' 

63B*Bb 1 *=^CHR* ■: 1 7 1 *CHR* <0 ■ +CHR* ( 1? > tCHR* ( 129 1 

(■siaeNDPROC 

64EREH= = = ----*===== --»■■««• = "-«- 

65BDEFPRUOI 1 ipse ( st art , end, » ,y > 

A 6BLGCAL a tGp , ang 1 e 

67BMOVE j+lSO.y 

6BHsti-|j <i»iuJ-start)/3B 

fc^HF-OH angls*atart TO and STEP ttcp 

7B0DPAW ? + 130*COS<Jiaql»> , y+45*5 Hn ■""}). ) 

JlBNEJ'T 

720ENWRQC 

?^avrM--<^ i i ll ^-. -. m m mmm 

740DEFPROCr»c t Angl ur(x t y t het jftt . *idi ii 1 

75BMDVE x,y 

770DRAU i *Hidth,f*h -iijht 
7O0DR(.W | , yUKitjhl 

790PRAM i,y 
HBBENOPRQC 

B2HDErPRDCm3VEstr i ng (x 1 , »2 , v , m* i 

H4B^RCj£>«lTid3w<w2-l,lfl,K2-t7 1 i, i,0,TRUEl 

05d< 1 =x 1*32; x 2**2*32* y* I »23-y* 32 

BtcVOUt 

B703CCL 0, X 

BBBflDVE i-l, /SPRINT st 

B90FOR X"X) TO nE-32 STEP 37 

<*B0T 11^ = 8: REPEAT UN"IL TIME -5 

"IBECCL 2 , 1 

".iWKHlNI -»f:rU]vE K+32 r y; GCOL O.ltPRlNT ** 

V40WEXT 

950MDVE Kl,y=P3INT «■.* 

•?iOnnaCi-ec t*i ly I w <4O0 , ABB ,23B t i i 

970PRQt;rue:t»ngl«<73a, 7*56-1,600, 350) 

"B0GCCL C T 1 

wcivniia 

1 B0BF Nl^ROC 

1C20DEF PRDCropt routine 
X£30LOC^L rep} yt f overXay n.imtawr 
1E4BPRIMT 'flbOff" Root = ?f8hl* 
HBBOREPEAT 

IBAOMB peril 
ie7ePHiHT 

X0B0PRINT 
IW90PRIHT 



"T^p« t-" 

' RETURN to exit trvi* dnnon»tnti on , or" 

' 1/1,1 D a- IA lu eiiLwr inothir routine" 

1100 INPUT -ecl¥ + 

lIlOUNTrL -Bpiyi-'MA'' OR riply*""l»" 3R reply p« "2A' 
R reply*""" 

1120 IF reply I*"' THEN 1170 

1 130r vi.t lajf_numtJ*r »EUflL (P1ID1 Srepl yl , I , 1 ) ) 

Xl40FROCo( "r cut in&* ♦reply**" (""FOD"""! ", over lay nunb* 
rl 

llofeFfcim MbH*T " Root ";fBfal*l 



IU,DITi:NT " rttui i fi uii u'rrlil> Clll" 
M7PUNTIL rap !>■*-*" 

UBJ UsM BP HO C 

1 1 9BREM' — > | , ■ iu i u i hh ii 

1 2BCDEFPRQOI nco« (xl t yl T x2,y?,f,b ,cl nrj 1 ag ) 
tZteVDU 2B,k1 ,yl ,K2,y? 

122BCDLDUR f 

iZJldCnLnUR b*!2R 

1240IF cl*flr_*laq THEN CLS 

L 23BENi:'PRDC 

1 2iBREP *»=u==»B«fc™n=^==J! 

127BREr' Overlay handLrr routine* 

lzocno' *■■■■! ■■■■■■■■■■■Miii 

f ?9flDEFPfiOEi-i*ti ^) i =(r_ovBf I *y ^hindlw 

1 3B0m.ru _nr* t -H s r oo t - 255i t h i « t ov Z«5 ( n*x _d»p t h*8 

1310011" OIC*tr 15,uv_n?4t mas nest 

l32A>v_idx>0IC!v ncsfBTCrat 

1I30SNCPROC 

1 3300EFFNom t tt rX , o v_c a II * ,av_na) 
l;c»idKtr routine to L.oad □•-erlay. 
l370LDCflL rrt,ret* 

L3SBIf QV_ld<>-™a*_nff*t ThEN VDJ 7,7,7:BaTTJ ]#»40 
UOfllr Dv_n.arA t3R uv_>iu>2=a THEM PftlHT illegal DVtrl 
#y'»ST0P 
1 4BB 3 v_ldi' "Ctv_irix+I 

M1BTF rwj fl«>m*«_t*f»|»th THEN f»iH _dep t h »ov_i d x 
1 42BPRCI>indQW (10 ,0 , 1 9 t 9 , t r , TRU£> 
143BPRINT f»*x_depthi 
l*^0ov n»»fov _id«=QV no 
U901F trii*_ov=3v^no THEN 15B0 
146QREM th« overlay *u»-. tic loaded Into mtar*. 
l*70PRO"ltK:v»*tring(4,23,A+2»iJv_no t ''O , uCR'+BTR*ti»v_no) > 
l*OBrJtaiQmc_rrtmnarKl I'LUflD aver "'STB* (av rton-" "+5TH*"" 

X 49Bth l »_QV"0V_fiQ 

1 =HOPROC-i rvd ow < ! , Hi , S2 , lit , 1 , E , FM.9C ) 
1S1BPRIHT Tft»ie,otf_id«)ov_callt 
ISOPROCvtkndciH (B,31 , 39 ,26,11, 1 , TRUE > 

1S30:F itrT, THEN r*t*-EVAL C"'FN™ tf>v_i--1 1*1 EtSC rot-GV 
H,H"FH"*fJv_call*: 
1340PRDCn~ndnw(:,2!i,2Z,16+3v_id* ,1 ,0,TRUE1 
1 550Ov_: dx"QV_l dx-l 
ISAMKkli ntted to lend overlay? 
X 570 ]F ov_T 1 «t*'ov_tdlK-thi«_OV THEN t&3B 
xsH0th i »_o"=<fv_(*emt'7 fov_idit 1 

lWOlF thi »_cv-tuoU THKM till S_OV»OV_nBStVlOV_ldJC+l >I G 
JIUIAJQ: r-:i n rEturn to root. 

16BBFEn n»d tn load previous overlay. 

X 61 BfRflCmo ^e st r i nrj < a , w=L , * +2»t t i ■ _e* , M OVBR " *STfl* < fc h i »_ 
Ovl> 

1 620FROCos<: _cn<MAnd C "L.DAD ovi- --tSTRt (thi* OV>** " + ETR 

1630FRDCh1 rtdoM (0 , 31 , 3? , 2tt ,11 , 1 , TRUE) 
164HJF %tr-i THE« -r»tt ELSE -r»t 
163afiEri™"i"— «™»"">»c====^ == 
X6!if>£l£r*PrtDCQV_E4l l*,Q*'_nciJ 
lA70nFftom(FftLBE,ov t:all*,nv_na) 

1 AOBUF-FFMSo ( {W_£il I * , a>-_r,n I 

17*0^"No» I TRUE ,cv_cal 1 *,ov_no' 

X72BD£FPRaCotov [..i.ll.uv no) 

I7SB.UICAL " 

l740t-F»oriCFfll.S£ ,Ov_Cil l**OV_Hfl) 

i73BBNDPFtDC 

1 /(,0H;lrl=»= ==»•««■■■ »■« ==" ■"*"==== 

l7?0OeFPROEosc_t:o™narvd (camn«nd*) 

17S0Rer1 Prnc. te jehiewH *LOAD 

] 7 70*utii. all - umiiifiiilt 

lB80XX>««CStr MCO 2S6 

iai0Y7.-tscstr DIV 236 

IRTflCw l ftFFT7 

193BENDFRPC 

Jfl4B'REMa"==End of Root^™""""™™" 



(coptffftieQ from ?re/iou$ previous} 

used since it has beeft sioiifisd. 

In lie ttemDns:raium lisiinij the size oft.-ic 

jverlayarea it specified 'Info should be us -J 
;o dcia-minc the sis; of rhs nvprtiy Hlit pio- 
Juccd. For cMiropk. 
9,g "INFOOVERI 
OV=R' 1£OOSOSF 2000 A7 

The s.iu o" Over! is &20W byiis sii trie 
overla> area must bi ai lu?si ihist hij far the 
overlay to lit Tm '.oiiil sbc if the prtgram 
will be: 

jfuyitmi sl;e = TOP- PACE; + overlay 
siie-2 

When choiuint lire ituinbcr-c, the rooi mcsi 
iiavc i he liwer Liiiv numbers *nd ihc overlay 



routine the aigher numbers. No overlay 
modjlc cam contain ihe same range of 
unmix:™ n* the root, but separate overlap 
modules can share lh« same raTH*e. 

r^m- must be ia**n wht«i curreciinr- triors. 
Tf iht root is chsnped lfitT an overlay h loaded 
and ihea Saved it *il! be toe bi| btcaise xnh 
root and overlay will .iavc been saved. AUnys 
U'-jtl I he root bf relevant ovjrky before enak- 
tT»iT JilTrmrifinf . 

Obscure errors can ari?e if ir,e overlays a« 
called incorrealy. Two erro;s oin cauju great 
ecnfusicn — Jusi'.tHf line numbers between 
the toot and ovetlay mudules and a.so ewj 
rouiine^ witIi t u> ^mi" nirat ocvurrinj m dif- 
krent overlay nodules. 





<s ■■ , 


<<i 


inf^ 


'4k 

'19 








'' **^^ ^ff - .^ 




*l(. 


'*4si5>f5f*'j^; 



IDS VOUR COMPUTER. MA'^GH 1*5 



Write programs to unlock the multitasking power of your QL! 

Use Metacomco ' s much acclaimed Development Kits to create the soft- 
ware for your QL : Use Assembler for its speed, and for access to the QL f s 
many features; use BCPL for systems programming; writing games, 
utilities, and applications packages; useLtSP for manipulating data 

structures, and for exploring the world of artificial intelligence. 




> Standard Motorola 68QQQ 
mremono. 

> English error messages. 

> Produces code which can be 
^XECed.and run as a 
concurrent pb. 

> Fxternal references allow iinkage 
to high level languages. 

> Integral I inker allows assembler 
programs to b° liiked together. 

> Macro expansions, 

> Position Independent, absolute 
or elocatable code can be produced 

> Conditional assembly. 

> Large range of d recti ves. 

> Fully J ormatted listings. 

> 30 character variable names and 
32-bit values. 



> True compiler 

> Muhiple BCFL programs can run 
concurrently. 

> Full runtime library includes 
interfere*; to QDQS graphics, file 
operations, window handling, etc 

> Exception handling provides 
diagnostics for debugging. 

> Link loader allows linoge of 
separately compiled segments. 

> Assembler and BCPL modules 
can be Itnked together. 

> 32- bit variable* uie the full QL 
address space. 



LISP 



£59.95 



IMC W,T 



iWCLLTPfS 

ASSEMBLER 



UNKEp; 



ANDREW 



Each language is supplied as a 
complete Development Kit 
which includes the sof:ware 
(on a Microdrive Ca fridge), 
Metacomco's popular full 
screen editor, and user 
manual. 



NAME 



The MetaCDmco Development Kits 
are available from HMV, Meniies 
and many other leading retailors, or 
direct frorr Metacomco. 

nEFRCOfSC 

26 Portland Square, Bristol BS2 8RZ. 
Tel; Bristol (0272)128731 

"Existing regislered gs?rs can obtain an upgrade. 
Coitart M^tacofTKo for details 
QL&QX)5OTlhGt'«tenair«ofSin:l*lrR#HMrhl1d 



ADDRESS 



fosicoDe 



TCL.hlO. 



> Full support of QL features 
including window graphics, and 
screen handling. 

> Compatible with Arnrmoft 1 isp 
for the SBC micro. 

> Interpreter. 

> Turle graphics 

> Structure edito- allows alteration 
of data structures. 

> PreTtyprinte- displays programs 
in structured format. 

> "racer to aid in debugging. 

> Garbage co Sector automatically 
recovers spare memory space. 

> 28-bit integers and 2 50 -character 
names. 

Phone toddy, or poit thhtuupar 
to:Meta:omco, 26 Portland Square, 
Bristo" B52 3RZ, 
Please senc me: 
The assembler 

Development Kit at f 39, 95 

The BCPL 

Development Kit at £59.95 

The LiSP 

De ve I :>pm ent K it at £ 59 , 95 _ 

lerclnsea cheque for £ 



r:r 



SIGNATURE 



debit tiy ACCESS/VISA Account Nc. 



Card expiry date:. 



P'erp mribdes WT, postage snd ^aclong UK ma inland srily Dclvcry ;i.i« up to 28 d ■■■■■ 



YC2 



YOUR COMPUTED MARCH 1985 109 



Thk invisible toolkit j> a suite of fast 
efficient much ne-coce routine* drivin by i 
shait Basic menu, l>ue .11 the faa that 
extensive use is mails: uf louiiircs ;drcad'.' 

proem in thj Rum the machine-cod'; U 
written in less :hari &00 byits, which together 
with the. Basic lines xcjpics less th;n 1800 
byte of memory. 

The program wis wiiticu lu ma*e it easier 
10 mutiny tnd develop t Btsic pr;>grmi and 
even combine two or more Bisk: pt 02 rams 
- or romu.es — >a that the idea gf bavifig a 
library of useful subroutines 011 cassette is 
quite feasible. In Addition, iht i~n iln> in 
cieati large Rems, or delete, them at n str>ke, 
is invaluable whei ;iKu-rrbli.i£ ma-ehir.e-eode. 

"lite TolUiwiny rout.ncj are avaihbk: 

DOWN CODL - used after Lp Code. 
Download* the copy .11 tj-jj^ci Memory into 1 
specified li.it mid Address. Space is auto- 
matically enjaled. 

DOWN BASIC - med after tip B:sic 
Brings the Basic copy (.own hto the Basic 

0.1K& placing 11 according 10 the fiisl line 

number of the block. 

LIKE ADDRESS — cives the adcres; ot" 
tile specified line number. The firs: character 
is four by lei further on. 

REM EXPAND - cxuuihjs the Rerr 
ttitesKXi vith the specified lint number, 
from a specified address, by 3 Riven number of 
bytes. 

UP CODE — copies a given number of 
bytes from a given addiem* imu uppei 
memory. 

UP BASIC - capita a block of 3asic lines 
specified by first and last line* 

BLOCK DELETE - iperify first and last 
lines. 

RENUMBER BASIC remimhers a 

block »f Basic lino speci:ied hv first and last 
lines. You ire a I tawed to specify bcth ihe 
Increment and ihe New first line number. All 
ncn com jut; J Chios, Gosh Li, unel Runs will 

&e carnal? change L provided ihe line 
numter is in fcur-ii..R.i form, cg„ Goto 1 a* 
Guto 000 1. 

RENUMBER COPY - used afier Up 
Rule Only requires the Inc. cumin aui New 
first line number in be specified. 

The order in which the routines are listed 
may seem ? little odd, but I his is a$ ney 
appear in the menu. This h dictated by the 
uk of relative ullwi hao, absolute |uni|i<- in 
the machine-code to allow it to be position 
independent, ami the entire rrngrm htsbeen 
written in such a way that, sa will as the 
machine coex, ihe Basic menu can be irsns- 
rcirtd to upper incmuijf — vfiihtuu over- 
writing existing upper memory contents — to 
albw the Leading i>f Mibsequent programs, 

Whjn required, :he menu car. be recalled, 
and it will not clash with ihe Dotting Risk as 
it* lines are nun beicd A222 to A235 — 10222 
to 10239, This is possible since the Rjm 
checks the validity of a line number liy oily 
comparing the high byte with 40 decinal — 
40 times 256 equals 10240, the first **non- 
vjlid" line numljci. 

However, line numbers in the rar.gc 10000 
to 11239 are <mh> obta.ned by using "Jie 
Renumber routine, as 9 9? 9 is the krgest line 
you can enter direct fiom the keyboard. The 
menu lines aie ijuw tugged un iu the end of the 
program you have u*t Leaded, 

110 VOJR 20MPLTER, MARCH T9B5 




THE INVISIE 

TOO 



Stuart Clarke presents a 
number of machine-code 
routines lor the ZX-81 which 
are driven by a short Basic 
menu. 



Repel codes. 


K/A234 


you have attempted to 
use Down Code when ro 
opy exists in upper 
memory. 


T/A233 


yiM hsi* attempted to 

use Down Basic 3r 
Renumber Basic when 
Iho "Iivd" copy I.3 not 

Basic. 



Systen variables. 

16368-16339 Ramtop 

16507-16538 Old Famlof; 

16444-16451 Poked by menu 

ZX61 . variable pointing to the 

first locatioi in the "lump 
table" acR#*ssino ihe 
machine-code routines, 



If trW typing seens a bit of j chore, just send 
ycur name and address with <t cheque for £.3 
mide payable to SargleT Software, to H7 





Scnitn Parki Road, Glenrotbtt) Fife, RY< 
I^TT, and [ will send you a quality cpsswi: 
with twa copies each for machines with and 
without the "improved Rom", together with 
ai instruction lea.liM. 

T\pe in prcpram I, lher. duplicate line 1 
using the Edit jtcy so that you have 12 
idcniicid lines, numbered I to 12. Now Rin 
program I. 

Type in program 3, and Run it. This is the 
Lex -wider. Enter [he address 16-344 or the 



Program f. 



1 PEH . . 

t-l*11V«T*P¥ l 



SC POKE 16311,. 60 



30 POKE 16512,3 

*CI FOR H-16E14 TO 1>*A? 

SO POKE N, 1 

EJ1B NfXT H 



Program 2. 

10 
20 



40 

50 
&® 

7© 
80 
90 
10© 
110 
120 
130 
14-0 
15© 
1S0 
17© 
180 
19© 



INPUT S 

LET R*="" 

GOSUB ©160 

IF R*=" " THEN INPUT fl$ 

IF n*="S" THEN 5TOP 

WET X = lfitCODf R»tCODE ft $**£:* 



POKE 5 ... X 

LET Y=Y+X 

LET C=C + 1 

LET 5=5+1 

PRINT ft$t 

LET R $ =R $ i 3 

IF C=S THEN 

GOTO 0Q40 

PRINT TH8 25 IY 

LET Y=0 

LET C»0 

PRINT 5;TRB S; 

RETURN 



TO 2J : " 
TO i 

GOSUB 



0150 



P'og:air 3. 



• 



icblet r=lE566 
SS LETT L=764 

30 r-jKt lii.w.i.,P.Sii(IWT (F,>9H 

--*« PJKE I&*tE ,L -2bn#±N \ IL.'^:-;. 



7B R^IMD U5R 16"767 
SB P^MC USB 16S22 
BU LET ZXBLPEEK 163S0 +fltj0*PCt 

H 1S3B3U53 
IDS ri&T 

lie f:r n=bjs_2i 



SM 



13S NflXT H 

L*0 PHIIIT RT ljlj 



15» P^IKT PT 3 VBji -ZXOi*", ZXftli* 

r s,e; -peek mm?** : pee*, ig&vv.p 
t ?,6; "peck a6B«e=-;PEEK I6SC 

i6Q r-^inT nrr i*,i, 



l?6f P^IMT PIT 12, 6, 

JMWIWT «T 15.J 
■9^B".H> i ■■ , t.. 

PRINT HT O^IW 




3P,:"jpt *..b; "S.DNB^Sic-r -;ht © * 

J"3.L|S RODP-. „IHE: "; PT B , B „ "A,KEf 
V EXP -LI WE :'1VTE. 3p£>H: "; HT 19 . O 
j"i.ur C3DI - ■ =ictl>a . IvTC . "; ot i:».n 
; "Ej-UFBHalC-- 1ST ■ „R&T r '" ; Hi Jt C 
:"7.BLht 5EL~:1ST ^AST:~;BT H& <P 
j "B. RE«g^,EJ-: 1ST : lBST; INCH HtUL 

. ■ ; =<t tei,e;-9.»euuH,c-.- 

in;rt. IICLJL . " ; !*T Sl,«,"EwTiP N6 " 

31B INPJT N 

3Ba PBisrr fit a«N.i,~B" 

33* FOR Hci TO A 

3*a INPJT i 

359 rni'jT nrr 3 <n P s •»**; " " ; 

3&a poke ia**2t-m-3, i-aiC + rtST <z 

3TB POKE lS4*a*Mt^ , INT 1Zy£3£j 

OOP- lldKT K 

39Q CLi 

J.P10 I* W-J Q» M-«4 THEM HflNC USA 

*10 II* N = l OA H=£ OP N*9 ThEN R 
UNO USPt <IXtHt573) 
*2B LET ZXBE=U5R < EAB l + 5f*M-8 I 
A3B IF Nil Oft HfcE, op N*9 THEN P 

4-4JS IT N=Ci TT1EH PRINT "SD&PC39 
ji r »_ rrie ■ peck iM<i4iESCTFrri< ic 
t-4-5; " ia " ZX6£ 

dESO REN 

46*5 REM 



P'ogra/r 4. 



a SfiUE -TOOLKIT" 
1-9B rusT 

Sac PDK.E 1B44.4.. l(HaS-iO(5t IHT , 1 
9332/355! 

21f P3KE lt>*A^ , IKT riB222r25e> 

S5B POKE 1R4H*.. IBS.TQ-SSmnjT r^ 



?30 POKE 16**7> INT C8a39/2j«l 

24.B fiflHO u^« li'Bltmi 

au *<»<■ 16***, 1 

S4« PCKE 1B44B,B 

37* LET Hm7 

9«e ooto ieaas 



appropriate addfesx ifwu are resim.ng nfttr a 
br»aW — stnH <>ir^' ttie lifse codes liR-ecl in 
(igtirt I. You may inter any nunber of byies 
at a time, and the screen display should idly 
wi'h ligure £, It' yon make ;■ ntisukc inpui 
"S", which will stop the program. To 
recommence, sioipl)' Goto Id, nnri enter your 
ne* sorting addreis. 

When thtt is compk'ic — and you ihojld 
lia^'e Saved jou: piogiam at several stige! — 
Save i he program thus fiw. 

If yOllf yX-Rl hus iF'i' Ll iPTiLinpmvi*Ll" Ruin, 

identified by Print ?ee.< H04 giving 253, then 
you rausl ciiler the five hokes in fi^.2 before 
Saving and proceeding, lurthcr. 

Type :n program 3. This is most of the 
Btsic required to transfer the owk to upper 
memory and provide the operating iikiiu. 
Wher. yiu ha*e Saved this, Run It. You 
should now Mvt the menu on screen, so select 
8 — Renjmbcr — )nd enter the ciumbefs i^Q, 
■160, ., aid 1 0232 ,n rjjip:«iv.- to the pronipts. 



Almost im^iediatilj-j th: menu Hoes will be 
^numbered from AI22 to A23Q - !0222 to 
10239. 

If all is well, type in program 4, ttt 
teimining tiastc, ind Save the program a':iin, 
Ynu arc now ready to Save thij, the fmil 
mmplcicd pn^rani in auto- run mode. To do 
this simply Rtn the program whiUi iccoidinn 
in the usual way. When the p-oE'3m his 
Saved, yni. w.ll find that The Baiic program 
jrca has been cleared and the menu lines are 
now stnred above JL&rr.lOF whcfi: I ley Will 
remain until required, sin: i tally, this occurs 
when you 1 ,oad th« auto-run version. 

The lnvjsible Toolkit is now ready to us:, 
mi r:iei to the inunctions and try it out. 

lUing ■ hi- lonUii is ***y- After IjOiding, 

RANDU&R(ZX81 t 2) 

retrieves toe Bask: Iron, above Kamtop, and 
GotD 10222 displays the mtiiu The first 

ir.nntiniiRr! nr next &SQB\ 



V 3UR COMPUTER. MARCh 1 995 111 



(continued trotn pievfavt pzge) 
pfuinii rcquiret you to input ynur selection — 
I to 9 — and the nest (our prompts expect 
nmmrrifftl input, for umampli: .in* number. 
Address — or any numbtr if the menu 
indicates a blank. 
When ym w.sh to Load mother program 



on which to usi: the :oolkit, there ire a ompk' 
of tilings 10 remember* ) ; i.*si make uirt thai 
rhc menu lines are baci abov: Ram:op — if 

nor., use Copy IlasiL lp do *ia. Then uoie down 
the contents cfltiL-afnnj 1650" and 1G5Q6, jn 
you will need to restore them after Loading 
Al»u ? ih» variable ZX-81 will ha?e to be 



restored after Load in; — alio aft*; Run and 
Gear, which ate best avoided. 

After you have LOADed :he program you 
intend 10 work or, and refiiorcd the system 
variables 16507 and 16508, md ZX-BI 

and away you go! 



Figure *. 

165X4 OS SO Dl 00 53 -292 

1633,9 CO 74 ?C EO SB 364 

16624 04 40 ED S3 7B = S1J 

16329 A® £1 CI 49 CD- =493 

16334 OS 4S DS 3E OS = 506 

16339 CD AS 40 CO RD =012 

ibb4 4 19 3D £0 F7 CO «69E 

16549 S3 4E £3 46 EB =ASS 

15354 S3 EB C9 EB ft? HJ^ 

16SS9 El CI C5 71 SS t76I 

46664- ^o EB PD EB SA -07C 

16SB9 atC 46 CO D6 09 =554 

16574 E5 iM* .<%F 41* F?S *43fl 

16579 CO t>6 39 Ol'CC = 644 

166S4 17 BP C9 2H 04 =260 

16599 -tO E5 2B 3E 49 *AB1 

1559* 13 12 18 F5 21 ^345 

15539 10 27 38 SB iO =196 

1SB04 3R 04 40 £5 cr> ^S44 

1=609 QB 05 £5 CD OS = 640 

15614 09 £5 Sfi ?B 40 =467 

1.3619 CD SB 3d. 40 CD =€31 

13634 17 OP £1 i5 CE = E64 

L60S9 *H «-'LF 9fc a9 CI -60S 

16634 Dl El CS ED DO =104-* 

1B63Q Cl CB Sn 3S 40 -460 

156*4 09 22 92 40 ED =346 

i Kniq 73 36 ia an 96 aaas 

16654 4(3 99 F9 A7 ED =726 

16669 42 ED 59 04 40 = 462 

16664 EB R7 £3 SB 44 -739 

166 69 4& ED 66 76 43 =592 

16574 BR 04 40 ED 53 =45© 

166-»9 04 49 19 66 ED «375 

1&564 66 IB 34 2fl 3C =363 

16080 40 CD D5 00 44 aSS2 

16604 4D CO CD 43 SE =632 

16609 43 SB 49 49 25 =277 

16704 E5 C5 CD SE 05 =793 

16709 Cl El CS 41 3E =743 

3,»7U IB 23 77 IB rc '449 

16719 13 13 16 81 IB =319 

16794 Bl 10 DO 16 OF -61& 

16723 10 S4 16 2D 13 = 151 

16734 77 IB 7 1 * 1« 77 a4PIK 

16709 £R 3C 46 CD 33 »337 

16744 e»9 ?l 30 »B 33 -39© 

16749 23 5E 33 55 EB =463 

16754 Q9 63 7£ £8 73 -316 

16759 3ft 29 46 09 22 =198 

16764 29 MS CO SR 3C =466 

16769 40 ED 46 3E 40 =533 

16774 IB 03 CD BB 43 -400 

16779 C5 D5 CS CD CS -1641 

IE 764 ec an 04 40 22 .jbb 

16769 73 43 R7 ED 42 »637 



15794 22 84 40 C5 ES =523 

16709 23 62 40 F7 ED =512 

1ES04 4a as sa 49 cd =403 

1E309 73 35 40 fiFt 36 =329 

16014 49 37 ED 42 F9 =703 

LS019 09 ED 56 76 40 =524 

16324 EB 07 ED 52 44 =789 

IbHW 49 3H 36 40 ED =474 

16004 7? 5D 49 ED SB =B0» 

16339 3D 4B ED BO El =795 

16344 Cl Dl DS EB ED =1937 

L6549 80 El Ol Cl C9 -1994 

1605* 10 0* 18 16 IS =106 

leo&y i* t^J us *o co -ooo 

L635* CD 60 Oft 20 29 =394 

16864 +9 fi7 91 CO *& -*fl(? 

lBS7t &2 39 43 CO FD =593 

16670 CB Dl EE Ft^ CB =«QR 

L60B1 01 A6 13 3fi FD =526 

1&803 CE 01 ^E FD CB =334 

1B694 91 f)6 21 76 **0 =3B9 

16398 FD CB 31 9E ES -344 

15904 S3 23 23 23 7E *236 

16900 FE F* 20 04. FD =703 

16014 CP 01 DE 7E FE =606 

16010 7© Cl 23 a& IF =417 

1B024 50 C5 7C CD 64 =731 

L6020 07 7E FE EC 23 =663 

16ft34 at l-C ED 26 31 -6P1 

L6030 FC F7 E5 ID FD -823 

L6444 CE 44 3C £3 eSS ^3S0 

16049 DF El 3D F3 09 =994 

lfiW* E« 6^J 5B 9C *0 -63^ 

16930 fi7 ES ED 52 El =940 

Leani p* 04 is bb is =a?o 

15060 B6 18 3C 23 33 =335 

1607^. 2 3 23 23 ES 7E =460 

15979 CD 54 07 20 2D =469 

1696* 23 7E FE 76 20 =56S 

16953 2 7 51 ES FD CB -949 

10094 01 65 20 20 S3 -211 

10990 7E 23 5E 23 56 =375 

17094 23 4E 23 46 CD -433 

17909 3D 13 C5 El CB =739 

17014 D0 09 18 02 18 =275 

_7019 BH E5 Cl El 23 =676 

17034 73 Sb 71 16 SI =460 

17035 Dl 13 AC rc? CB =363 
17334 91 66 26 S3 C9 -432 
T?B?)« SB 66 2B 66 EB -Sa± 



Figure 2. 

POKE 

POKE 
POKE! 
POKE 
POKE 


17051 , as 

17054 *S4*1 

170S2 , as 

17091,28 
171±0,SB1 



17044 


CD 


B3 


35 


4S 


46 


=536 


17049 


CS 


CD 


50 


15 


CD 


=550 


17 OS* 


F3. 


13 


21 


El 


ES 


=914 


17059 


CS 


23 


77 


23 


73 


=591 


1705* 


23 


72 


33 


71 


33 


=332 


1,7669 


70 


Cl 


51 


S-B 


16 


--S97 


17074 


92 


19 


93 


16 


04 


-193 


17878 


C5 


DS 


CD 


20 


13 


=799 


17034 


EF 


CB 


34 


01 


OA 


=494 


1T609 


00 


C5 


20 


15 


er 


=497 


L7094 


Cl 


03 


a* 


CO 


El 


=853 


178 OS 


3 1 


C? 


Ol 


03 


ec 


-4.SS 


17104 


34 


c:> 


87 


BE 


cs 


=635 


17109 


CD 


C3 


15 


Cl 


Dl 


=S33 


17114 


El 


CS 


1C 


77 


as 


= 5 13 


17110 


16 


ea 


65 


10 


96 


-440 


17124 


IS 


C5 


an 


76 


49 


=453 


17129 


22 


46 


40 


2fl 


C4 


=214 


17134 


4® 


FD 


CB 


01 


6E 


=531 


17139 


29 


13 


00 


BB 


00 


= 36 


L7144 


00 


00 


09 


2R 


3E 


= 104 


;714B 


40 


20 


CD 


D6 


09 


-#24 


1 ^Jt?4 


32 


46 


40 


2P 


3C 


= 370 


17159 


40 


CD 


D8 


09 


?'?. 


= 49* 


17104 


CO 


CP 


*B 


46 


49 


=44V 


17 IBS 


ED 


56 


42 


46 


C5 


= 655 


L^l^?4 


DS 


Dl 


Cl 


7P 


FE 


-151 


17179 


28 


36 


03 


11 


0F 


= 131 


17134 


27 


72 


33 


73 


2B 


;\if. 


17189 


EB 


99 


EB 


ce 


OS 


= 0B9 


17194 


CD 


F2 


09 


EE 


ED 


= 926 


1V19 = 


SB 


46 


40 


£7 


E5 


=521 


172B4 


ED 


52 


El 


20 


DE 


=796 


1720S 


Dl 


Dl 


FD 


CE 


01 


= 675 


172i4 


ES 


FD 


CB 


01 


6E 


-797 


17E19 


30 


16 


8E 


^>J 


FE 


=661 


17 aa< 


27 


CD 


frS 


99 


33 


= 504 


17229 


23 


SE 


23 


5£ 


13 


=289 


17234 


13 


7E 


l!B 


7£ 


19 


c3ie 


17239 


2D 


Ol 


03 


ee 


CS 


=rf4-a 


173*4 


ES 


CD 


8E 


99 


Dl 


= 616 


17249 


Cl 


SI 


76 


49 


eo 


-6S0 


17254 


00 


C9 


CD 


23 


0F 


= 632 


175S? 


SI 


FE 


S7 


CD 


Da 


=~ra.-7 


J7264 


09 


33 


23 


5E 


23 


=306 


172B9 


£6 


D5 


IB 


16 


73 


=467 


17274 


26 


73 


Dl 


r>s 


19 


-£■0^' 


17279 


7E 


FE 


EH 


20 


07 


= 653 


17284 


31 


SB 


72 


26 


73 


-524 


17389 


CF 


13 


Di- 


01 


32 


=433 


17294 


09 


C5 


ll 


7C 


49 


=402 


17299 


CO 


Bt 


23 


Cl 


E5 


=678 


1T»4 


69 


en 


ti 


uu 


bit 


= 770 


17309 


OR 


C<3 


2H 


04 


4a 


-321 


17314 


7B 


rc 


-LO 


9! 


96 


=47T 


17319 


an 


76 


40 


2B 


7E 


-39B 


17324 


rc 


76 


28 


02 


C 


3621 


17329 


LC 


C9 








■ 



112 YOUR OQJVPinER.M^KCH 1965 



./vr^r 




9M , . ^ 

Ik 





Space $C*n 

A mint for every woub-he Fiitrmiirmfi, 
Discover the key stars, rcbulaeand 
ga ixtcs of the Northern Skits 

4&K Spectrum 

£5.95 

Quiztimer 

A .mique multi-f?arture qui; game few no* 1 

or lvw> payer* Tpn hiiKf f|iri' file* pro 

vided - or make ycur own Superb 
graphics, 

4flK&MCSrUflJ BBC U 
£5,95 £6.95 



The Sunflower Number 
Show 

Battle af&ittD drought, 3 deadly wvwW m 
poison yy tt» 4**0 your H,T.rtl<«n (rcMH 
disaster! A colourful t«t of WHSrral ariliv- 
metir fnr~;ill.iKe>. 

^aK Spectrum bbc e> 

£>.95 £6.95 



All ttfcotrmxntfnl retail prkt f inehxftig VA T. 



Snappte Hopper 
Tops and 1 'mm 
Castles and C towns 

to -un-pnctal fwn-kci giving kids £ htad 
>lail in reading, Dcviwil by B-?tly Root, 
one of Britain's top rcttcin^ experts, 
Unjctrable value -tiwgameJOfi each 
( assert?. 

4BK Spectrum BBC Bllet ron 
£5.95 £6.95 



Available from your local software dealer. In ca«c of difficulty cunUct Martin Neild on the Macmillan Softwarp hotline 01 836 6633 

MACMILLAN SOFTWARE 




■:■= . 



TUTO 




T I1SMOKTH 1 corrplelo the description ofthe 
6S0OB in struct .on sr. which 1 started last 
m,>n!nj. I also provide a brief introduction In 
QDOS. 

Th-ce instrLctions arc included wt.ii.-h 
Opera e on byte si«d Operands an J perform 
Bindary Coded Decimal -BCD 
ar.ihmciic The add decimal with extend in- 
struction AliCD wida tbt source 
operand and destination operand and extmd 
bi together using RCD arirhmeti;:, placinR 
th: result in the desdna'ior operand and if 
necessary setting the CSCKltd bit to allow multi- 
precision BCD arithmetic. 

The operandi must < it her both be contained 
in daia registers, or else in memorv loorions 
addressed indirectly through address 
register. In the case of memory in memory 

addition only :hc pitdiCrc mcivt addrcvJii£ 

mode is ivaiiab.e, to fieilitats mult i- predion 

addition. 

The si-blr-jct decimal with extend instruc- 
tion — S3C3 — subtracts tht: scurce operand 
and cxicnd bit frotn (ht ekatiiuiin.i opeilttd 
using BCD arithmetic The addressing modes 
arc [lie simt hk Tor ihr ABCD instruction. 

The negate decimal win eiter.d i.istiuctiim 
— NECD — sublets the destination operand, 
which b ifmzc byte, and the exfffld In , I'lnm 
ec-o placing the result in the destination. 
Thus the instruction products the Un's 
coup, erne nt of a BCD number if the extend 
bit h reset and the nine's complement 
otherwise. 

?ro5,ram comro) bttructkm cover jump, 
branch, set tnd retJim, htth coruliiional and 
uiicoi dji:oml. First, a word about he 08OO8 
notation which I find ennfusirg. To me a 
jump U '.he dTuembkr equivalent »f t CJvio 
instructicn whereas a cM is the eqLivalent of 
a Gosub nsimaion. In the 6HOCri instruction 
set both branch and jump — BRA and JA1P — 
are used us Goto end branch tu sth routine 

And jump tc subroutine — GSR and _"3R — 
are used m Giisuh, 



The difference heiwccn branch and jump — 

I whether ic sub routine or rot — U as follows: 

A branch instruction can cause ^ru^ram a? 

cviuion to continue ui u Jii|>!ni.t;iiieLiL i dative 

o tie prtifarn cnunter. The displacement can 
'x either signed byte — to ;ive a short branch 
shown as a suffix .Salter ine instruction — or 
signed word. This produces position indepen- 
denl code. 

The jurrp instruction on the other land ran 
use manv difTcirni addressing nodes, and 
thus allows a jump to an address greater than 
plus or minus 32K from the prog.'air. couuicr 
a'IulIi is tlie limriaiitm of ihe branch instruc- 
tion. Tn fa"t < jump can use any effective ad- 
dressing mode other than the obvious ones, 
;,e, register direct it. odes, -jfe-deercment and 
pov-in;;rcmer.t modes and imrncciatc modes. 
L lie cundii.onal iostmct.ont ptovlde bran- 
ching and setting on the following cxndrions. 
The tabic hdnvv shows the ttrwmoriit, the 
coniixkm and the stite of the flsigb fb~ the test 
to sice;cd. Mgtc that true test will always sue- 



ceed , 


nd 'tie lalsc test 


will alwa/5 fait, 1 lie 


3ode 


Condition 


Test 


r 


true 


1 


F 


false 





-ii 


hi E h 


ool C . not Z 


LS 


low or same 


C + Z 


DC 


catry clear 


notC 


33 


frilly M:l 


C 


ME 


no: equal 


not Z 


EG 


equal 


7. 


^u 


overflow cleir 


not V 


•s 


overflow set 


V 


=L 


pits 


noi N 


VII 


mlhuf 


N 


3E 


greater o' 






oqual 


N . V + iiDlN nn! 
V 


_T 


less than 


N, no! V + net N . 
V 


■3T 


greater than 


N . V . not Z + not 
N . not V . rot I 


. a 


ss or equal 


Z + N . not V + 






net N . V 



Phil Hoiiiday with 

more on the GL's 

assembly 

language. 

L 



equal twt will only succeed it't.le XCTti (Z) hit 
is asiert;d. 

So now on to lhe actual ins: ructions first, 
the brand) .nstructiotis. I he branch always — 
BRA, branch conditional — Bcc — and 
'n-.jn.-h to s.throuL.iw — BSR — at I prsdLCt i 
prograrr. counter relative brand i. The cendi* 
tional iiistjuctioii is formed by taking the re- 
qjitud conditional rrnemonic anc replacing 
the cc to give REQ,BNE etc. 

Tbrrf \% al«i a ten gondii i tin, decretnent 

and bnnci lustrutiion (DBcc) which I 
described l^si month. 

I tt lump instruct i. >ns lbllow a similar pat- 
tern and are hump — JMF — arxl jump to 
tvibroulinc — JSR. Ycvu mrill svt- tHac there ii 
n.i c:>tu ituTia! jump and S3 if you need to 
jump raher taan branch conditionally yon 
will need to perform t conditional branch to a 
jLitip insl reel inn, 

Xht* srr TCCC-rdi.ig to condition instruction 

— Sec — sets a byte operand to true — all <3ne-i 

— if the condition is iruc, else it stts the byte 
to ta.se — til zeros. 

There arc tws Return instructions tc enable 
return from a sutroLtini*. Rfnirn imm 
subroutine — RTS — pidls the program 
counter from tjc top of the >tatk. Return and 
restore pulls bctti the condition codes and pro- 
gram counicr fmn the stacs, Note however, 
lh;ii bmnrh and jim^ in fl-hrtnitine uisiruL-- 
tiins do nm st;ire tht condiiion cede?, on the 
stack SO if you wish to use this instruction 
your subroutine must store the cendition 
codes on the stack a: the start of the: 
subroutine, 

Svuem control instructions all into three 
categories, Le. privileged, trap generating and 
statu* register instructions. 

As was briefly mentioned in last month's ar- 
ii, li- ilii- r>,MhiK ran nperarte in ptO diflWwU 
modes, nanely user and sup^rviser inndc. 
Swperviser mode is the indicated by hit 13 of 
the statas rcg.stc- bcin* set, and provides 
acme adJiriinal instructions — i.e. privileged 



IV VOUR COM PUT Eft. MARCH SMW 



instruction* — which are not ava liable when 
ope rating in u*er mede, Tl ny are as folbws: 

Thriitt instruclione ar< provided lo provide 
rnnxdiile bitwise logical manipul.it kn of the 
Status Tigifttr. Tiey art GUI to SR, AMI ty 
SR and EORI to SK an-1 all have ate word, 

A specia. mavc innractica, nio.-e io status 
rti'^itivr, in avutajle with opeiaiid sixt ward 
which ullows ".he whole of [he status register 
to bi leaded. So far all these insuuetions ate 
privileged because they potentially can set the 
supefvijftr bit ift the stat is legbtc*, at.d Llis is 
not a fecittfy ivailaHe is prog'Tirris rjporjiiig 

in user mode. 

There v also an insimctioa to move the 
user stack pointer to m effective address, i'his 
enables (he u»r stack to be examined wlitrn in 
™p*rvis*r mode. 

Aid mally in he privileged se: of instruc- 
tions there are Stop which halts the progra.11 
execution, Reset which relets external device 
and return from exception - RTT: —which is 
« return fr.>rn ini^rruplf, trips and pills bo'h 
the status register and prolan cmurtcr from 
the stack, 

Thcrc are three trap generating inn rue- 
lions, trap — Trap — trap an overflow — 
TnapV tod check regime - again*) hum d* — 
CHK, A rrpp forces exectdorr to continue at 
an address held in a table of 'vectws ncti the 
botiom of prrgram mmicry anJ also uuih.m 
the procesior to enter supervisor node. There 



are 16 Trap vectors, and the first five, tc., 
Trap # Ibices the piocessor into supervises 
mode Tiap 1,3 and 3 are sysiem call trnps 
with the particular caf recognised bj a 
number passed in dO. 

Trap * 1 is. used by the Basic command in- 
terpreter. Tie other traps cm he ~ed retted 
urng a QDOS ?ystr:m call. "".'rapV is usee to 
force a crip an iwcrflow mi thai the program- 
mer has control of the situations when ihis 
would <>r would not be catastrophic. CHK 
allows the content* of a dala register to be 
checked :igjiinti *&mt hiMin:iary cnnciticmK, 
forcing a trap exccttlic-fi if the data rcyisicr is 
out ot btruuds. 

binally, the stilus register instructions 
which ar-; not privileged, The cnnditiim cade 

register — CCR — is rh«* Iw hvr-- nf the mliuk 

register. So AND; to CCR/ORI to CCR, 
EORI to CCR Move lo CCR are all bte size 
versions or itu. simitar instructions ilrmdy 
described in the privileged irsi rue lion section 
above. Then; is s*Wi 3 rnflvr Slams register tc 
ci ccuvc acdre&s which allows lite status 
rcgi&lcr lo be stored. 

A brie. mimductiou 10 Ql>QS is an tsieii- 
tinl pin of J serifs ;m ussimhlei on he GSGDS. 
but brief is the operative word. To rki futftlei 
to th. subject would require a book, and it 
Part 1 o' this series I gave the names of two 
scch bocks, Jso instead ol anempui g i> cover 
l lie viricus system calls, etc, 1 will try to give 




you th: flavour of QDOS without going into 

What is QDOSr ft is a col lection of soft ware 
procedure] — system ceIIs — which can be in* 
votod by assembly brijua'c programs — us- 
ins a Trap instruction — to pertVmm uniinicn- 
ly wnjuirel operations on iht QL. 

Thew: >pci at ions include manager traps 
which manage the QT.'s r^smrccs, .u alWu- 
tioti traps which allocate input and culput 
channels arte serial in trips which execute 
wr*\ "v'o nprntlttiMAnd in'Vudc all the icrccn 
driver rovtinrs, 

An executable program — i.e. unc wJiich is 

aci.vaied -jsin^ t.ic Usee conunand on the Ql - 

{continued on next page} 



m 


OBJECT 


ETNT SCURK SMTEKHT 






41 








2 






42 ithti do Lt ill again 






3 «<l|jri^tf,*.Hollidiy 1SB5 






43 








4 Jd**4ft!tr»ti<M ol lulti-Ust.ng 


0«B' 


us 


44 


tit.i start 






S ttniitltd with HCTAEatlCC iittatltr 






45 








t 






4E Hub rout 


int to jo trn 




=ffff 


1 thii^jjt fqc -I 






47 








j 


0C1A' 


47TA W1B 


49 nag 


ifi plt.blkral 




-tin 


3 it.susjb *qu « LOB 






49 


BIOS at.iBttw 




<tltl 


10 ■tjpen tqii fill 


wir 


7011 


4*« 


****% lil_ip<s»l*tf ,d0 






11 


01 »* 


4E41 


4* 


tap Iitjpt»^l0& 






12 QDDS i-ji.iu 


0122 * 


6142 


so 


bsr.s dtiiy 






ii aavtq hutrr,^ 


0*24' 


«73 


SI 


rti 






14 trai I\l/tt04 






52 








IS fidl 






%l (sub rot 


>ine tt su&pend jcb for 






1G 






54 tO.E s»( 


Hidrl.r.40 fraies 






17 tt.rst i nit 14 tit lovf) CtintFr 






55 








IE 


0)2 1' 


VJf 


3E dfrl.y 


wv(( Ifiiit.JullidL 


owe 


HOC 


IS star! ...-j »..:,. 


002fl' 


3k 3E 002E 


57 


ton v ito»d3 






« 


00 ?T.' 


4JC9 


58 


suta 1 al.il 






21 itlitn p trrrjrrr 






59 


m$ it.sus.b 






2i 


00?E' 


7M8 


5* 


iov*| tat_SL5jb^Fr r 00 


0002' 


Hit 


2! la;p bsr.fi rin; 


C030" 


4£41 


s* 


trap lut.tuijb'llQO 


000*1' 


tin 


3* fcsr,s rinj 
2$ 


(032' 


CI3 


60 
61 


its 






1\ *n»u uit a bit 






£2 tparaatttr 61*1 for lt«p 






2: 






£3 tthtst ntf t found by 'ml ard t'fit 


04K< 


(in 


11 hw.« r#U( 






64 








21 


WW 


H 


65ftr fall 


k.b M tttp EM 






31 taoif loop back 1" <J2 not jr*: ■ -1 


D035' 


(A 


u, ' 


Ji.t 10 M of ptrs 






31 


mi' 


fFFO MM 


S7 


ilt. 1 ifFF^OMA tttf itinj 


MW 


SIC* FFTB 


j> dtra d.rlmji 


e03A f 


M 


ta 


j;.J3 10 pitch t 






3) 


4038' 


CD 


61 


k.b 13 pitch 2 






34 trail u nt lor SO stcs bj- suiptftdmi j« 


W3C 


{002 


70 


Jc.i 32770 fljndj. 






35 tlor 3000 fr.ats 


603E' 


1120 


7) 


ie.s 69'4 djratNn 






X 


««' 


M 


71 


Jet fi yafl.y 


CKJOC 


72fF 


37 tartq tth9«_jobpdl 


W4|' 


11 


73 


k.t 1 wap 


MCI 1 


36X 06BB 


SB to"#.« *3t 00,43 


wr 


10 


74 


lea f«p.d 


M12 ! 


33Q 


3 'iuWJ alial 


)W3* 


tO 


75 


act luti 






"> QDDS at_sisjB 


5044' 


11 


76 


dr. t 1 no rip. y 


am* 


T00B 


ao* i4<#q iit,«>i«]htitrr r 40 






77 




0416- 


4€41 


'0+ trap ««t_siasj3^f tOO 






70 


ind 



YOORCCMPUTER, MARCH 1 %S 110 




(continued irotn previous f>£ge) 

- or on which Is in the resident procedure 
aria j nil is en ecu ltd with a C»l command is 
krnwn as a job A jot: cai bj if ui'.c of tl.ree 
diiti.net r-uiisi, known ab dUi.t, mj^jli ded ui 
itiictive. 

QDOS svp pons a nnJii-t asking envuon- 
mem. Thai s irorc th»n enc (obcar appeal in 
be running at the same time. Thb is not in 
fact vha; actually happens. The 6U0UB piv 
^ciKor tan enly execute MM nistructicn itt u 
rirru , an£ so each jcib is giver: a pricsntv lii l J is 
alloc u*c J sin appj opiate slice nf the processors 
time by he scfedultr, whici is activated nO 
limes ,1 second by the hiudwaic iurcuupr. 

,\n active |ob will have a pi rarity of from J 
to 127 the higher ihc number the Ertater 
the amount ui" rime allocated to n by the 
uchcdulei A suspended lob will fc»v; ken 
created with j priority juil like nil active job, 
bin [he scheduler will nor allow it to run lor a 
given nunber <-l* time slices. An uiact.ve iob 
h»a pricrity ofO. The mtnaper raps eiable a 



jobs priority tc b; charged, for it to be 
.impended, fw ii io be removed, etc. 

Oiher manager rap$ control allccatiofi of 
memory a the lianneitt procediiie are and the 
msjdenl procedure area, enable couittiuni;;i- 
lioii with the second processor whic-i hi miles 
lite we uti io pons, sound generation and the 
keyboard, finally, i lit re are a set of trtps 
Which allow QDQSlobc exrfnHt-H wit* arldi. 

I tonal user writien device drivers and idler' 
rupt Servers, making it possible for instance to 
i.- a i. -nd QDQ3 u handle d.ik drivo Or 10 per- 
i'orn terminal emulation. 

The io allccat on traps enahlt 1 : inb^ tc np-n 
and close channels, to fbnntt med.a f.nd to 
debit files. 

The serial .o traps er.abfc data jq he ciad or 
written roan opened cfcrnnel either E byte at a 
nmewasa siring Of bytes. The screen Hrhvr 
comma nth cover operations td modify 3 win- 
dov, control the cursot, clear a part of a w.n- 
dov, set the colour; aid perthtm some 
eupluj operations on ii window suc.i a* pl.it, 
draw «c. Thire are slso <uim« mps tr> enable 
the file subsystem to deal with direct recess 




files and cr.tire file load and save. 

There ar; a bo some uliliiy murines which 
are rot strictly a pm at'QDOS .n Thar rhey are 
not essential to rr.u operation ft the QL, an;! 
rhe most inipaiiiiit of" [fatta utiliti*; ic the 
Basic interpreter. 

This months program example will produce 
a sound like a lelcshcne, whilst an* other pro- 
gram, either Bjul or executable machine 
cads, is running, J'he program it commented 
and is self explanatory, To run ir type Exec 
t"i I ■_: t j, i r 1 1 ■? — t :iavs cillei mini phone eic — 
and it will ring 12 rimes, followed by or*? 
ni mulct's delay, ifter which tl wi.l repeat ad 
nauseam. 

Next mo.ith I will presert a m^jor routine 
written in assembler, it is a dcbig program 
whith will allow registers and flag* m h? 
displayed and changed, pro^runs to be loadei 
jid ihtn (inpl-e -jicpptid. and tct-ral other 

[centres. 



CALLING ALL ARCADE EXPERTS! 

SENSATIONAL NEW GAME FOR THE 

43 K SPECTRUM: 




A game which rakes real ski he gut a high score. A game 
which tests your a/e .your aim and your reflexes . Basec 
on s fairqrtjL.nd shooting gallery — but hflrdar' 

The main lea:ures sre: 

• 1 00% machine code for *as:, smooth action. 

• Superb giapiics and sound (yes, SDundf) 

• Accad3t>pe hylt of fame, high score table 

• suitable for keyboard, Kernpstt3n or ZK2 pysticks 

Rusiri£n,yo1hBrexcitir9 features 

Send 3.A.E. forotr "Sharpshooter" facts sheet. 

There'* nothing quite (ike i,! 

Send cheque for C 5. 50 (he . p < pi to 

"KOBRAHSOFT" 

"Pleasant View' ' , Hulme Lane, Hulme, nr 
Longton,Sloke-on-Trent, Staffs. ST3 5BH, 

ALL ORDERS PROMPTLV D SPATCHEO 

DEALER AND D13TRIBUTCR ENQ JIRIES WELCOME 

PMSTRAO VERSION CQMtKG SOON! 



AAiCRO 
ANSWERS 

70-71 Wilton Road, Victoria, SW1 

(3minut5s Wo Hi from VclO'iu Station] 

* SOFTWARE BARGAINS * 



D?AGON 
VIC 20 
ORIC 

B.B.C, 

CBM64 
SPECTRUIVI 



Arw2apes 

3-5 apes 

o or more opes 

Any 2 "apes 

3 or more tapes 
Selected titles 



40%effRRF 
50ii of! R R.F. 
cVOXotfRRP. 

lOXoffRRF. 
25torfRRF 
SOtoHRR.P 



♦HARDWARE AND PERIPHERALS* 

I'appie HE + Disc dNve + Controller + 4 

SANVOGreer Screen Monitor EoW.OO 

B&CA[Busl<zZO.S1.2) E236.0G 

D RAGON Delia 1 Disc d rtve £1 90.00 

I EFSON FX100 Frintsr £450.00 M 

COIVMODORE 15d1 DiSC drive £175.00 

TEXAS Dec drive + ConloWer £240 .00 

TEKAS32KxBBAMeyr>CP!iinn £ SaQQ 

I WE5HA 90 adjjslabte Work Stations £ 6*.00< 

GP1 DO Printer £i9QO0 

Bo oks u p to 2 5% O F F WideSeleclioris 

P All offers a e subjpet in a*oiiabH iv, Fricei irclude V A.1 4 

Open Monday lo Friday, ICtam tc 6.30pm 

Telephone 01-6305995 



116 YOJR COMPUTER. MARCH 1985 



FALL GUY 

^W^fl/RESULTS 



Two tickets to Hcllywood were on offer is 
the fust prize to January's Ftll Qvy 
competition. For the nwusttfup Uimc *tt 
ihree RMX bikei. To be h [he running you 
hid 10 identify jighl computers from their 
photographs. 

Then we as.<ed you to drearx up a title foT a 
lew blockbuuer TV scii« ui film atxui 
computers. The com filters in iht photo- 
graphs were as fo.lows: 1. Enterprise; 2. 
Spectrum + ; 1. Neivbfflin, 4, Atiri 60 C XLj 
S. Acorn Atnm; 6. Acurn Electron; 7. Text 
TX-SOH); ». Cominodore ?lut 4. 

The hope of being, Westward Rnuud 
inspired a number of highly entertaining 
entries Film buff? will spot the references 
among the following suggestions: "I MirrLd 
3 Rlnb from Sinclair Resotret" frum A, 
Mi.Ier; "Indiana Jones and ihic Architecture 
of 'he ftHUUT from P. Manulis; ''Hackers of 
thu Late R0M s from A. Johnson.; and C. 



ljnc s "The Kilobyte Syndrome'*. 

One of the >esi v>as V. (jar rot's "Core 
D.nary! It'* 'CurjormaE,". This w« jnsi 
pipped at the pott far (he one of the first 
prizc> by "Qwcrty Harry with Squint 
Eastward" from R. H. Storey 18, Conifer 
QosCj Lutlerwort3j Leics. We awarded the 
udici trip to IlnlljrwticiJ uj J, Minor, 6 
iViuswcll Avenue, London Nl ? who sqppliec 
not jiisi one title but i complete TV schedule 
fcr a new computer, Channel 5: 

5.30 7XECLIVC AND CHniG SHOW 

Zany slapstick comedy Irom c 
Csrrpndge pub. 

6.00 NEWS 

Fcad bv a Currah Speeci Unit. 

6.30 KNIGHT RIDER 

Thriln mid spills as Sir riiv#> rnkft* tn 
the road in his trustry C5 , . . attfrr 
carkl Who is the rryslery uampjte^ 
mAQriAtR in the Rolls Royce behind ■' 
Last in the series. 



7.15 a.t. DONCLE 

The cop wth tha cetachible bit. 

Postponed f ram June '984. 
B.OO SPACE TREK 

The good ship Enterprise f nelly arrives 

somewhere — even tetei than Q._. 

Donghr' 

9.00 NEWS 

With sub -titles for those who couldn't 

underSl&rid tho lurrah 
9.30 THE BIG FILM: THE RISE AND FALL 
OF THE ROW ADD-ON EMPIRE 
iDiaootar movie; 19311 Tho dramatic 
fortunes of Dave Ian, Brjce and 
Eugene, lour kics living fast in a wpild 
thai define? liYvagiiiarifsnl Nlnl >ujilj%MA 
for children. 
1 1 .00 INTERNATIONAL BOXING 

Ja~k Ttamijl v( Tho KcimmodOr? 

Kiler. Plus sfte' the (last orders) bell 
actior f'om The Baron of Beef, 
Ciin'tbridfje Rlr-ftrl r rr hvtss aftftflfi. 
Not suitable for anyone. 

12 00 HAWAII 5:0 

Stjv« MflCirro 1 . in^o*tig$teF * Z5d$1 
Error Code in the Pecitic. EBrW) 

12.30 CLAIRE RAMERS POCKET 
COMPUTER 

Claire Ramer is feced to betray tie 
confidences of more etieiv.s in order to 
af'ort new Fprotna foi rwr Psi-in 
Organise', 
1.00 SHUTDOWN 

CfusMi by an oveiheuing power 
supply. 

Working on the basis rhar. anyone nvcr IS 
was too old to win one if the three BWX 
bikes, wt swarded men instead to T. Blade, 

{} Valley Guiikns, Duwuuid, I3j iarol, S. 
Nolan, 43 Hhajicinann 3d, Liverpool; H\ 
HaUon. 39 Primrose Line. Burton Ave,, 
Hinsler. Lctds. 



— 



S^ 



UTILITY 



zffi^rfr* 



Of 





#*£ 



THE 



The Quill 



VKAR 



& The IUustTi 

The Graphic 

Adventure Writing System 

For The 48K Spectrum 





The Quill £14.95 
CILSOl 1 

30, Hawthorn Road 
Barry. South Glam 
0446 - 732765 



The Illustrator £14.95 



***^ 





Ficm Ctniipuler shuL»> Nationwide 

Orditect frtvm us by post or phone 

Credit Card Order Line Staffed 24 Hours D-My 

0222 -41361 Ext 430 



«^ t 




TA SWORD TWO 



The Word Processor * 
"if yots have been looking foi a wotd 
orccessor, then look no further ~ 

CRASH lm# 1<W4 
"The r.umhes of on-screen prompts, 
together with the excellent manual, make it 
ideal - even tor an absolute imyUm^r " 

PERSONAL CCMF LITER WORLD 
September 98* 
"Without dojbt, the best utility ' hive 
reviewed for the Spectrum " 

HOMi COMPUTING WEEKLY April 9B4 

TASWORD TWO ZX 4fi K Spectrum £1 3^90 



TASWORDM5X 



The Word Processor 
The Tasman Word JVocessor for MSX 
■niaocDmputers 
All the features of fie SueiLmin version. 

TASWOBPMSX MSX Computers £13.90 



TASCOPY 



The Screen Copier 
Screen copy software for Spectrum witi 
Interface 1 and Am«trad CPC ^64, Print high 
tfti jIujum iueeu copies {in a choice of 
sizes), and a bo large 'siaded' cooies with 
different dot densities forth* variojs 
screen colours. Tascapy supports all eiglt 
pin dot matrx pfimerswi:h Epson type 
control cod«i. e.g. Epson RX 30 Jnd FX SO. 
Shinwa CP-60. Mamesmann Tally MT-EG, 
Star DMP 5 10/515, 8 rathe' HR5, and also 
Amstrad DM- 1 1 with the CPC464, 



TASCOPY ZX Spectrum £9.90 

TASC0PV464 fcmrtrad CP A6A £9.90 



TASWORD 464 



The Word Processor 
The Amstrad implementatior of Tasword 
Two plus many extra features. ' 



TA5WORD464 Amstrad C PC 464 £19.95 



TASMFRGE 



The Mail Merger 

Transfer data from VlASTERFILE \o 
TASWORD TWO 1 Letter* and forms typed 
on TASWORD TWO can be printed with 
addresses and data taken from 
VIASTERFlLE.The mail merge facility allows, 
rorexemple, mi tiple copies cf a letter tn bs> 
printed, each containing a different name 
and acdress taken from your MASTERPILE 
data. To useTASVACRGL you must hdwuite 
or more microd rives as well at TASWORD 
TWO and MASTER FILE tjy Campbell 
iysterrs. (versior 9 or later). 



TASMERGE ZX 48K Spectrum £10.90 



TASPRINT 



The Style writer 
A must for dot-matrix printer owners! Print 
your prog ra rr m jtp i it and Isti n gt i n 9 choice 
of five impressive print styles. TASPRINT 
utilises the graphics tapab lities cf dot- 
rrtati in piini^is tu form with a double pass 
of tie prirthead, output in a range of five 
fonts varying from the futuristic DATARUN 
lo t he ha n d-w ri t ing style of PALACE SCRI FT. 
'ASPRINT drives all dot-ma:rix pri rite's with 
ait mage graphics capabilities and can be 



jsed to pr-nt TASWORD text files TA5PRJN1 
gives yaur outpLt original ty and style > 

TASPRINT ZX 48 K Spectrum £9.90 

TASPRINT Amstrad CPC 464 £9.90 



TASWIDE 



The Screen Stretcher 

With, this machine cede utility yoi cenwrite 
your own Basic programs that will, with 
normal PRINT ststenerts, print ontc the 
screen In the compact lettering used by 
TASWORC TWO. With "ASWIDE you can 
double the informal or shiwn on the 
screen! 



TASWIPE ZX 48K Spectrum 



£5.50 



TASMAIM PRINTER INTERFACE 



Plug irr.o your Spect' urn and drive any 
printer fitted with the Centronics standard 
parallel interface. Supplied comp ete with 
ribbon iabfe and driving software. The user 
changeable irterface software makes it 
pa^ to send rorrtrol codas to your printer 
using the method so successfully pioneered 
with TASWORD TWO The cassette also 
cuntairs fast machine cod* high rescluton 
full wicth SCREEN COPY SOFTWARE for 
Epson, Mannesmann Tally, Seicosha, 
Shinwa, Star, and Tandy Colour Gapiic(in 
colour!! printers. Compatible with 
miefpd fives and ZX Interface 1. 



PRICE 



£39190 



TASMAN SOFTWARE 

All p i <.(."• in dude VAT And post .in d pdLkjiginq, 
Telephone o-ders: L«?di(0532) 43B30! 

# Avjiliblp frnn laiger broichei <j\ Boots. 



C=~=X 




j 




1 SOFTWARE C 



Springfield Housa, Hyde Terrace, Leeds LS2 9LN. Tel: (0S32) 438301 



If ysu cd not wjril to cut this magaa ne just writ* 
yOuf find* r and post to : 
TfttM. AN SOFTWARE, dept. VC, tpringfald 
H&jM.Hyd:; Terra<j, Le*dt LS2 &LM. 

i efKlfMe a d%*Que>P . nJdr parable to TaSfn in 
Sohwae Ltd. OR <hirg* my ACCESS numb** 

NAME - 



COMPUTER 



ITFM 



PRICE 



ADDRESS 



I 

[as— — ^_ 



t 

Ov^de Euro t>» add £ 1 for ndi item 

aifmaiU TOTAt t 

Stndrnethp FREE Tasrru n hf ochu re i — i 
deKnttng yo\u produftl. fife h>f>i I I 
I wiOuli like to knart iTigfe dbuul your 

rxSpwtru-nQ VSX[-| ^maradCPC46dQ 



t18 v OLfl COMPUTER. MARCH 1985 



TOP* 
TIPS 

CHARACTEfl SET 

Thia short machine-cede 
listing for tti? 48K Spectrum 
instantly reitofinas the com- 
plete Spectrum character 
sal, giving aiy urogram tlat 
piof es&ional took (sets 
betowi, U occupies a meagre 
30 bytes but tie character 
da: a i: creates lakes up over 
760. 

Tvde in :he listing and 
than save it be (ore running. 



ILLllL 



»li fob r*SxKj -a Gust: 

a- «*r r,i twrr r 

WH HMMUt HJUI L,-jJLRl 

0*31 MTfl M.i.Bi.ir.sr.Ste.i.i. 

3, W»j,r*J .Ir.ivs. in , »»,,-*., n . i^j 

. i ^..iw,i)<i .Sa.i/.^s-i .■« .bt .*i ,y 






Hid 

II 

4L3 TWI P?If.T 



E ■ 



PRINTER/PLOTTER 

Owners of Commodore's 
1520 pnnte^pfotler krow 
that it has the davice rumbcr 

instead of trie usual 
number *, This meals the 
plotter cannot tue jsed as a 
printer will" software that 
uses a prirler with device 
nurnhfir «. This short roullne 
(below) allows :he pit-tie to 
be addressed with a 4. it is 

activated by Byft G?Q. 

< Hi* V*iV. L0W to fl**U 

J Pfrt | St niNrii/PLirilR ru ujl 

a nut p;"iunit uy '«» en 

4 spi hi*r ai (K-<rHftTED w'TLi: 

v n.i ft u-'**' 1 TAwl 

if Hftmts); 

."■i «Lm*i iwti.»6?».fl 

»i I*K1 

*» mm )«,£*, U1.2l.l.jia,».l-ct»;7 J 3) l 

H,i,njiB 

11 HA'* IK, XL. 4. IM i. 181.(1. s59.L<fc,l» 

Mt.7«v*,;»a 

FILL ROUTINE 

Delow is a maehire-cadE til 
routine. It is possible lo 
break it with Synod Shi I 
and Stop, "he rojhne also 
some times breaks itsel' to 
prevent a crash, When yoy 
Run the ^rograii. it asks you 
where lo pace the routine 
Ftemsmber to pir it ar.nvp 
Ram lop. 

Example: Putting the 
routine dl 32OC0, 
Type CLEAR 31 9S9, RUN 
Type 32000 

5AVt e>arrpie: (stfd 32000) 
SAVE "llirCOM 32000-95 
LOAD example' 
loac -tin "C'JDt aauw 
Use *he roLima f his way: 
PLOT INVERSE U,y LET 

1 = USH routine *aaics£. 

- 

3 ITT . nS 

'lip \*0 to w 



i«.i s*s in., 

66, 7T JSS m 

so: it* ': 

,-,7 " 



-^ it 1 

► = -«.;-.;. 

£.lift ' 1 
19*. 65 if L 



Vr . jUj ,3- -t {! t.K,;-.l 1I.IJI 



RESP 

RETAIL PROBLEM 

BPlease in Minn any ttafrwure 

reiaiUr?. rt-ddii^ iliis magatfnc 
that no I aW of ibeir ^Uitofncrs 
art budding pirate?. On pur- 
s'h t-iiT.^ a «l[l< for my ZX SftC- 
irLin, I fjuiut thiii ii iv hi. Id not 
load. After several al tempts us- 

ijifl a -,-aripty of isip' 'W»<«* **» 
(rj and load il iii, J Jtcidcd lo 
rcrnrn il. I hi- lii^il rnomihj; ] 
niuk !l back com pit: Ic with 
receipt cf purchiiic. Kuwever T 
they insisted on trying it <>" ilteiT 
i, i fit- recorder una toinnuicr, To 
tuy surprise, It landed- 1 >v:i^- 
ili-n ssked lo bring my i't>ui|mti>i 
iuLO tht ecn;rc. ,Sa, in Uir aJtcr- 
noon I ii'itk til ny computer far 
ihcm to try with their tape 
rirjiirJcr Ai I cxpccicd, il tlic 
not load. Tncn 1 whs told Jiai 
because the tape ltnnl*d an thair 

michinc Irtcrc was nutting 

wrong with It and I could not pc: 

my money truck, ritme wJJ mc, 

have I the riyn in Aiy nn m.-« 

back? 

Cwji' lt"r/. r .'-, 

Viirtli 

Of cxx itM- ycu hive. Under the Salr 
orGowU Att , the prcduct to tl li »s to 
be juiiabt; t'o - the purpose fur wliicb 

t| wa n>ld You i t-ape plniity " ihM 

itiulie. 

V...I, ;ifc Nir tpo paiicnl. I VVUttll) 
liil^C efusdJ to bring try Mmr/uctr 
into The iinri; izrcatird ± tccoc; ki- 
■,i:.i.lJ i I i, i i ilk ittttttgH bu ra led ;inJ 
demanded — in i ve-y Jnud voice — 
Thai 1 &vi my Ricney batk. 

1-iiilitiit ihii, 1 would — s& ] havs 
dune in tile pusi, 1 an not ilwiy*, a 
popular iii\[.miKr — cilice in I he 
lo.-»l 1 : ait Tiadiip, a*Tifcr yun rai 
limj cm who rhu b ,'rora youi iour- 
i'il ut cLiL/er.'s idvirc centre. This 

Uiii.n in/djriiblv bnnj;; rLJultj, At 

die v»ry least, th-cy shdutd hat.'c 0'"" 
Iiti-uI in eKchiiagt yuur ,i | ■■■ (a 
jaoilKr one ot tt-c same catT.Ci sod ,f 
tris did nut loui, i^tfi you voir 
dioocy btck wiihjn.ii: quihhlirig it all. 
like tint reply W tbt s or e, anl df- 
ii'jtid yuur money Luck. 

COPY DUMP 

■ I ii.lm- nn Alpb.itoii, 22 prjatcr 

MlCAch'cd to wr*y SpBCttuna. I hiiva 

discovered ihai while t eaa ditnp 
h>rc-i pi.'tures from the screen nf 
nearly all csnimcrcLtJ pru^ruiia 
I own — such as Valhalla — I 
l annul Jo it with I he Hu'ihi;. 
Hoes this mean thai ihc 
Alphacom is not dually coinpnti* 
ble wilh lh« Srjectmm? J only K« I 
rubbish when I in » €«py 
tranl«S from 'the fiobbit. Why is 
dUbT 

Shixbttrytt!}, 

I RAN'f: Philip Machelt, the pr* 
Kraitmtcr who wrote Th? thfrhii aid 




Do you have a 

problem related to your 

micro? Tim Hartnell will do his 

best to heip. Please include only one 

question per letter and mark it 

"Response Frame", Alternatively, 

perhaps you have an idea you'd like 

to pass on to others. Why not write 

to us with your top tips? 



put your question to hin., He *«d 
the fault dees not lie in yo.ir frinier. 
The pr-j^nni imis wrilleii in luc.i i 
wa) that il is ntil poxvihlc to access 
ibe Ccrav ^oiinund jehile a hires 
picture is wi he *cricr>. Hcwcver, 
you sluuld tia\e no trouble dtmping 
ri*vi 

TUNEFUL BBC 

■ Recently J A^iL'hcd vi cuiliuIO'* 
ci«l pi'-L-t of -tbfiH-iiTi' litiiilint; on 
it BBC Micro, and UBS nrrtHteti (« 
hear a rune being played at the 
ftame lime. I think diis is i very 
good idea, as il U otlen Ko horins; 
waiticij for the pro);rsi:i to load. 
Could vou te'l mc h ™ 1 could do 
ttritr 
.■V ,-1 th&nd, 

To DO in Sj jau hov: to be able lo 
diwrt the CPL"'s inlfirupt a\h to 
your own prolan, whik tttt other 
loaJmi, cuntii ucs T vii. mean» you 
hare tcgoiiitc machine cede. Th;rc- 
fot?, it h nut a paT.iculurlj easy thin-c 

10 fJo. 

WHICH MICRO? 

11 am Hi yew* old And aiu 
thinking e-t imty i iji my lirst u>in- 
pulcr. I im mi-.iiily tliinVin^ uf 
iht CiiTTiTTiiiJnrc fit. The ccm- 
puier I buy will be used for play- 
ing games a ad doing romc sim- 
ple pruflramiiking. 1 haec read in 
miny magarioei, Iitcluding Y>u> 
Computer, en mm cuts thai the K4 
ij diJI\vul| (i- pru-r.im, and that 
an upgraded Basle -lumlil be 
h on i; In Lor |]ii<i purpose. Could 
you fitase ten me If c£e *4's 
Basic is adequate fir my use, or 
shsuld I buy a btitir Iti^it. lf^u, 
Mfhich one should 1 buy? 
Vi'Kon JuiJrihum, 

Nertfkk 

1 1 B LMtULETittu talk about huy- 

inj anitpfrnd;d fpisii I'nra ■-unipnT^r 
you have nut yet tiicd, Mlhi;;, Linatiy 
pcaple — peiaihl/ the hirgcfl ciimj |- 
t?f kuibjsuilji- u'.vii.i.t ,a rhc vorld 
hj^e fiu.nl rhe &4'i Bask more .bur 
adequate. It it not, however, an easy 



Rasic to use, "it'iil" exlrenieK un- 
friendly griJ|phk> and sound com- 
ruands. Despite Ihiie, exireincly^otd 
rciul 5 cm le ofclaiaed. 

If you jr.- still in the beuiimn 
s.at;ei of using » computer, which I 
iKsume j(Mi tre Irom yojr letter, yt y 
miRhr hi> iH!H«r icfvid with the Spe- 
tiim, or Spsctrun+ J if yuu ljh le* 
ucpt tlic flon-star.dard feeybotfi. 

Fi«mlW t if you earn aJTord ii, I buj- 
gest rou sheuld sefiisus y invesigate 
the EBC Mkroor Atrtstad,, ^silteie 
five you mctn to tons pining pmvir 
if i ,v[j.ida:d chilli lae Spectrum 
and 'Jorn mrdorf 64 do not poucs!, 

SAVE MY WORK 

Hi ti.iM- recently been worklag 
on a loop, iomplex graphic] pro- 
gram for the ISK SpeeLrmu, but 
iave hit upon disaster. I record- 
ed over part of my only copy, 
incf so T an now unable to use it. 
Every :ime I reach that spot in 
loacinc, 1 get a tape loadiag tr- 

ror. The luut lin* Ion J*d, 6 J IC, W 

rilled with question marks. 
Deleting this line docs nothing, 
fs aert any way I tun save my 

work? 

'} ..\lt,',V.'- 

It S^EMS that the s.mpJesi Wiy ro do 
i would be lo LLbl !he corrupted 
version, an J lype it in a tain Aid, 
never wily lakf Oitt 44py of mpjr- 
:am prcgraiii, 

M/C SCROLL 

■ l urn wrilii] K ro yeU Itl intjtlire 
H'lirUlCi il wettld ht plfeijiKli: for 

you to write mc a small ma chine 

language routine which would 

scroll ASCII ih:ir;teiLT\ rig:it and 

left, as in Fro£f>i"-'f This would be 

Tar my Atari GD0XI.. 

S Haenceif 

Weit /!' ■«;;.■!,'.' , 

HTV'f :\\ULitdt. 

Ronrni-is nn scrolliop verticilly 

and horucntatly ipptar fron pi Lie 

3lX1 cmwjinl:. ol the rrt-nl! (Wa/**tn»j 

Ob ^WJ b* 1>l rryi Stvern - ISBN 
907^61 HKP - w!uch Co»ts £5.95. 



VOUR COHPUrER, MARCH 1985 1 19 



ORIC JOYSTICK 

fyiiifnble for use with Commodore 64, Vie 20 and Aiori 

Top Fire Button and Side Fre Button Fast Action 
Interfccefor Oric l/'Atmos 
Interface "for Spectrurr ZX81 



£9.95 

£11.50 
£7.95 





TRACKBALL 

Improve yotr scores and skills wilh the Corn outek Trackball. Sutcble for 
use with Commodore 64, Vic 20 and Atari £17*95 

Interface for Of icl/Atrnos £11.50 

Interface for Spectrum ZX8J £7*95 



COMPUTEK JOYSTICKS 

For use witi the BBC Computer. Metal shaft, 2 fire buttons 



£12.95 





PM CI 6 CASSETTE DATA UNIT 

Desigred for use with Commodore ±4, Commodore t>4 and Vic 20. 

This cassetle unit is a device for storirg ard recalling computer 
programs on ordinary cassette tapes. It car be used for saving 
programs you have written and want to re^o'l for later use. It can alio 
be used to read pre-reco'ded programs that you have purchased. 

£24.95 



DUST COVER 

Clips orto the back of the Commodore 64. Pivits up to ol ow use of 
keyboard, fully moulded, clear plastic dust cover. £7*95 




CRICATMQS £125.95 




_^^rT _ _ TRADE ENQUiRiES_V/ElCQME 



ORIC DISC DRIVE. 



£225.00 



r~ 

t Please ssnd rro the fallowing 

I I on close rry cieque^P.O, Ttade payable to: 

| MICRO PRIDE LTD tor £ 

NAME 



CKICJr'KINItK , ,.£129*95 



03 IC MODEM AND 
INTERFACE 



ADDRESS 



£99,95 



1 All PRICES INCLUDE POSTAGE & PACKING ' 

MICROPR1DL LTD. 

UNIT 16, SHIPYARD INDUSTRIAL ESTATE, 

BRIGHTLIMGSEA, ESSEX COT OAR. TEL INQUIRIES O20fr 3D49ST 



120 'fOUR COMPUTER, MARCH 1955 



Sawmil 



Nick Hockaday, 
Sh&pherds Bush, 
Loraon W12. 




SOFTW 



A COMPANY WITH tree plant aliens connected 
by trails in timber country Ins fcivtai you £ con- 
trac to supply their four sawmillc with lops. 

You liavc hired three tree fclinpi cr;ws and you 
have a :ruck with which to transport crews or | 
in urilmt mid dehve. logs, i-or safety rcisotis [ 
vou cannot trEnspon lo^s and artws ugciha\ 

A crew i.iai hi& bttn dropped ai a plq mutton 
wil) work diligently vhile you use ihe truck fat 
other business but the crew will not move to 
mother plantation units* you take them then:, 
Yot may call & crew r o you by sounding a siren 

on «au' track. 

Your iruck can carry a mcrittPtiic ofmne log* 
but if you attempt to overfill it, yoii will find 
that uji.nhi;r log, will tail oil' and be osi 'lie 
maximum spued of the truck is governed by Lie 
terrain and the log-load. Kach sawmill shtiwn m 
fr«n the lumber of logs that i: h*i in hand Jbr 
processing, hut if the number is less than 30 the 
display is white. Thsse numhtrs will decrease 
^riodi^ally at the logs are processed bin will 
ncrvtiftc il'ym. link- a delivery. Your koic thill 

iho* the total nam Mr of logs 1I.31 y»u hwe 
delivered. If any saunull runs out ol logs thin 
your contract is lermir.ated and the gitmc it 
WW. 



Programs for Software File 

should be fairly compact 

and sent on a cassette. 

Please include clear 

instructions and say what 

computer it's for. We pay 

between £6 and £36 for programs published. 

They must be double-checked and submitted 

to Your Computer exclusively. 




Operating instructions 

To trove truck Ncrth press A. 
To rrove truck South press Z. 
Tr* rrifivn trunk West prrss [). 
To move truck East press P. 
To call crew pess C 

To Qui l p'C09 Q- 

Tj Hold press H. 

Tj Regime alter Hold repress H. 

Tc drop oil a crew, stop the trjck on the tra I 
aVvn^sidz the required position and press (he 
appropriate direction lay Rersrese of the 
b4m?y tick you musr net carry a crew if you 
ate driving on a plantation. To pick up a log, 
P'css approprmit; dLutstion key. u you inadvet- 
icntly diivc into a tree, it will be tip-rootec but 



wi'l rwt ti," s'litsditr v<* * liig. liir m sawmill 
To deliver logs, itop the (ruck on ilie trail 

alongside any sawmill and press A, 1:" th* truck 

is nn a trail you may call a ocjrby cmw to vou 

by pressing C 

Tft ftuee rie program, iksi type ;ind *av* 

program I. Then enter aod run the hei 

loader. Nov, cuter pugmn 2 ind save it 

using 

SAVE "a" CODE *0672,iQ4 
Mmt niiM and sav^ rh» program 1 

with; 

SAVE "f CODE 40672,1420 
Delete the bet leader u:id ciucr and save 
pragnm 4. ^^^ 



Program J, 



£ *£h "I 

t ILEAR 39999 

»RJNT AT 7,1 PflPEP B: PR 10 

*T 1<"TIMB£P !...., & wick hockp&g 
1533" 

5 _OflD _ a "CODE <1067£ *0- 
1B SBHDOMIIE L'jR *10*0 

la _OflC- "C 



1Q 
-46- 
■ -£B 

30 

Sff 

60 

'0 
S0 

«n 
+2 

104J 

ne 

i pa 
ne 
t t 

B ■ r 
150 

160 



DEF FN h <*»J *16± (COPE hllll 
17 AND hlfil |-'9l J+COD£ h*l£ 
^17 AND KB il' »**«!•) 

input "stiri **;* 
iNfLTT "Fini*i ' ; f 
FDft n-S TC f STEP S 

if- iot)» psihT r. ; " 
IMPUT hi PRINT h», 
LE' <=0 

FOR b-4, TC L£N hf STEP £ 
IF*" 7=Fhl hlh«l LET tOt=LDt 

POKE n+i ,2 

LET Ki»4*l3 TO > , LET X*X*] 

WF¥T h 

PRINT " ■ ■';: "NPUT \ : P~IN 



IF tOtOt THEN PAINT "instil 
or - xru d(<ir>' ~0 TO 5P 
NEXT r, 

REM tntir 6TOP to Slop 



Progf&m 

40d72s 

406S9; 

40676: 
48734; 
40712s 
40720s 
40728: 
407361 
40744s 
407521 
40769 : 
48766! 
40/76: 
4B?e4; 
407«?2 : 

400001 

40B0BE 
40616; 



BBF4EFB^BFEF4A=A = 1503 
EAEAEAE*BFBFBFBF - 1694 
?l><H4?B9e9B9F4SA(8 a 1263 
«QAQfiaE4 E ?B9B9B9F - 1356 
e<7F4?DDD0DDI]4e~C - 1525 
CCCCCCC49DDDDDDF = 1630 
9DF4444444444434 = S09 
44444444 444444 9F - 635 
B9F4AEAAAAAE4A-u~i - 1361 
AAAArWWW*E4BF4 : ?F » 1332 
9DD4eABECECE4BCC - 1337 
CCECCECECE49F49D - 1532 
4<U48LECBL8E4444 ■ 933 
ASAESi:BL:eE.4Vt- 444 ■ 1149 

AA£4ftet:?77eE4BF'( « 1377 
BETJE777ABE4SF4AE - 1222 
DCElQGCaaaBQCl-r^ - 1157 

BC8Cni3CC49048E ■ t TSZ 
ABE 44 4 46664449F4 - 1021 



iWh.'*: 4444b£i64444444UE - 6^14 

40^32t 8CE4AAAAA4AE49E4 ■ t i69 

40B40t HB-4Abftttt£At4At3E = 1 J4i 

40B48s A8E4eEECC-CC49D4 = 1435 

40B5C,: 9r>-4eAeAQA6E40EC - 1265 

40664: flCC48E*444444444 = B18 

40B72: 49i-4BEt:CC:t:E4fcAE = 1319 

40080: 44448E£AA«a-ftPA£ == 1036 

40888; 49P4BAE777BE4EEC = 1255 

40B?6x BBF4eEtSECCCCECE - 1497 

40904 J 49D48CC3338E4EAE = 1E57 

40<J12! 9OFA0E£SE7778EBf£ ■ 1249 

409201 444444^666444ECC =7^0 

40928: B9F4eCiBC2228CBC = 1149 

IQ^Sti 4AAE4BBBBBSF4444 = 1024 

42944: 90F 4444446664444 = B45 

40952: 4BEC49DDDDDD4EBF =1310 

4B?Af)i e^BBB-F*ftftftftftE4ftA - 1375 

40968: ABAE44i444444 _ FD ■- 940 

40976t 9FDFr>F*BECECE4BE ^1^19 

4U9U4: LtJ_t40tftrBHt*bbfVtll- - 14Z4 

42992: 9D9D9&48CSCHC4BC = 1279 

41000: tiU8C49BDDDDDDCDD = 1458 

41008! 11409C21DF9E23D5 ^ B99 

410161 E51 130A0AFED52E1 ■ 1173 

41024! D 1 D0a602AFED6FCB = 1151 

41032: 5F2806E607F6A01B = BtB 

41040; lDCB372Bi3E6032e - 651 

41049= 07FE022B07AF 1B0E = S23 

41056: 3E40iB0A3E601B0& = 348 

41064: E6033C07C6201213 = 567 

119721 KBD219C200 - 444 

Program 3. 

40672: 003B5C7C33 101000 = 360 

4 0660: 00001 13377FF99FF « 850 

406B9: 00a000E0037E7E00 = 252 

40696 s 00083C3C3^3C:0000 = 240 

40704; D5E5C5F5110F0021 ■ 949 

40712: 803ACUE50/5(- 1C1E1 ■ UB6 

40720: Dli9D5E5C5F5J 10F = 1326 

40726: 0021B002CDBSB3F1 * 665 

48736: C1E1D1C9C5ESD544 = 1^5 

40744' 4mUn44fl/FHS777 - HH1 

40752 s 6069U409OED5268 - 854 

40760; 691 1405C330F 1140 = 430 



407 69 i 

40776; 

407 B4: 
4B79.Z: 
4HHWfl: 
4 H 809 1 
40816: 
4BB24: 
4SB32: 
40S40: 
400 48: 
40956: 
40064$ 
40872; 
4O8E0T 
408E8 1 
408'r6 - 
409B4 t 
40912; 
409201 
40928; 
40936s 
40944: 
409S2i 
4 fl 960: 
46966! 
46976s 
4B984: 
40992s 
410B0: 
41008s 
4iniA; 
41024: 
41032: 
4 1 040 - 
41048s 
41056; 
4 1 0b4 -. 
41072: 
41080s 
41IBQQ: 
410^6: 
41104: 
411 12: 



9EEOj260t9114B55 - 044 

360311 404 EA7ED52 m 704 

D 106061 A77 132410 - 439 

f *iElJlC*/Eai51iJ6B - 1233 

2680292929292^5A - 333 

1680191 14091 19EB - 544 

ElC9C57D'S33fl02/B * 106U 

954F7C9230027A94 = 9 IB 

BI3DC1C9E5D5114H =1107 

4*373FED52CBBbDl = 1099 

E1C9E5D5 11464437 = 1072 

3FEDB2CBF6D1E1GS « 1464 

D5C5F5ED5B94A4CE - 150B 

5C9FED53 I ?6A41A32 ■ 96 1 

9CA4ED5B t *8A4m?ir m \7f*% 

9FED53'?Aft41A329D = 1630 

A4ED5B7CA4AF2A7E - 1123 

A^EOS230d2CBC7A7 = iBBi 

2A90A4EB522B02CB ■ 890 
EFA72A92A4ED5220 = 1661 
Qittm>7$?.'HrM<F\Cl - 1227 
D L FEO 1 2A94A4C8FE « 1272 
022A96 c t4C8FE032A = 857 
V«ft4Ce=E04 J 2A9AA4 = 113* 
C8FE052A9CA4C32A = 16*3 
9EA4C9ZBF4CBAZCB = 154H 
E434CBA54D3E04CI> -> 102H 
AB9F7211F89E73CD = 11B1 
249F3E02CDP09-71 ■ B?6 
1L0Q3D3E28CB792B =544 
023E30CDZ4SF3E03 =577 
nT>-09F727CA4C934 = 1105 
7AA4FE0 121500028 = 674 
L9FE02213E0B231: =432 
EE072t30e02B0AFI r = A47 
04212600Z86321 IE = 1B1 
0B22B€A4AFt:BlEC;B = 949 
ir>7--EW4^ 1200022 - 470 
92A46F672275A432 = BB9 
79A t 2284fl422aAA4 - 949 
22Bafl4229Afl43C32 - 7B0 
74A43279A43C3C32 = 7B5 
9EA4210AB9227CA4 = 696 
2^!/tW4^^a0A422BZ = 814 

{continued on next psyO) 



YOUR COMPUTER, VARCH 1385 121 



SOFTWARE m. 



porrmjec tram previous pajej 

41120* A421 32001 10AB022 » 300 

*l iiTH3 oLP4lY£:it>kH41V£i: ■ i64 

41136? ?0F4l?227;A42l40 « 7L0 

41 144: 9C2277A4L1EA9EAF - 1047 

41152* E5EDS2E1302E7ECB = 1 19i 

41160: 7F2Bieefe07F&A877 - 945 

41168i liE09E3E3eCD249F - 7BV 

4117£s 23]BElCB772B0AEt - B66 

41104: E077U0«3D3E2B:B = 547 

41192: ECCB6F2QEBt 1Fh9F = i*?S3 

41?00: 3E^B1BE121^R915.?E = 771 

4120B: 707 7 11FB9E3EtBCD = 1025 

4171** ?4(fFC?ED5E7Cft4CC a 1217 

41224: 5C9FEB0401CB7E2B = 362 

41232: B206053A7EA4S04 7 = 557 

41240E 2105901 IftlBBI^B - ?7 

41249; FD22SCfl*Bt032lO0 = 633 

4l2S£i raJiBD0222£5ED52 - £>02 

41264: E12«F?10F121B3A4 = 11J5 

41272: B604235E2356L372 = 393 

41200* 2B732310F5ftF2AB4 =303 

412001 A4EB5BSCA4ED52D2 = 1325 

41296* 73A2AF2A86A4ED5B = 1120 

41304s BEP4ED52D235A2AF = 1225 

41312J 2figefl*ED5B90ft4ED = L215 

41320: 32E2F*>A:AF2AaAA4 - 121 B 

413201 EIHB72A4ED523BAC =1165 

41336a &76F228AA41 179A4 = B52 

41344: ;A474FFE032001fiF = 64 1 

413521 3C132i7CflJia32310 = 485 

41360c FC5E2356D5CD5C9F =1136 

4136Ba LAD16B62CB7FCA03 - 975 

4I37il ME40&290AFE:02ZS - 743 

41384s O8FE042B061C1C1D = 397 

413921 L31414152294fl4ED = £.65 

4 11BB. ^3ieA4D3CDGC9Flft = IC?-* 

4140B: D1EA1SC203A1217C = 976 

41416i A44123231^C7323 = ?17 

414Z4t /2Jt0iii:i>A09FCB9E = 1063 

41432* CBF6C36E1 10B3D2S - B8B 

4 J 440: O311Fa9E3E30CD24 = ?&■? 

41446* 9F3E04CDA09FCSDE = 1174 

41456: CD929FC303Altt76F ■ 1063 

41464* 22BBA*2A77A457*7 = B17 

414721 3A7e5C5F19llE09E ■ 7Q^ 

41480; A7H5FU52E 13805 11 = 13 IB 

4146B: A0O2ED5 22277 A4E6 = 1078 

41496: D32B0104 7BF6C047 = fa77 

41504: ;EE6F??0200CGBEE = 1234 

41513- CDB£HE0<?E3E30CD - 1B^<? 

41520: 249FCJ03Ali>7tiF22 = 802 

41528: B6A43A7*A4474Fil = Bl^t 

'r,J:ti 6Am^323lBFCSE^3 - 737 

41544: 561B722B737AB320 = 716 

41552; I0064B21C05A3610 = 471 

•11G6B. 2310FB3E0332B1^C = G3H 

41568: C9413E07B032B1EC - 734 

41576: 79FE042H01PiF3C32 = 697 

413H41 ^4fl4CV676FZ284P4 = 1025 

M592: EE5B7CA43AH05L:4 7 ■ B37 

* 16001 3A045CBB383178FE = 769 

4-1608? 4FCA2BA3FE5ACA27 = :0?2 

41616; A3FE4lCfi29^3FE50 = 1222 

^1624; CA25AJFE43ZS:AFE ^ :043 

41632: 51230VFE4BC2D3fil * B14 

£1640; 3LB2lS023Eai060A = ;69 

41648; LD1Z9F1BFB32B15F => 970 

£ 1656s C93^9EA4FE33287D = :003 

4]664t 3A7BA4A72077D5CB = 10B1 

<H7-h 5C9-E&tp7E3l2atD - tlAfi 

416B0: 2A7EA4CD729F470E = 895 

416BB: 012AB0A4CD729FB8 - 99? 

4t6?6: 3«HK?47B[;Z(!B2A4CD - 674 

41704: 729FB830020E8306 = 536 

41712; 0ACD0HYFCD12VF10 - 772 

qi/jTU: muzzi fLHnmzsi!^ = vi/ 

4172B; 10FC5E2356E5CD5C = 10C9 

41736: 9FEBCB9ECDB49FE1 - 1476 

£1744: D172ZB73CD5C9FEB - 1172 

41752: CD929F219EM343E - 979 

41760: 0C32B15CC9141D1C = 561 

A176B: lCH>i41SAFBA2e«|> - 512 



41776* BB2805I3E21BA2BB5 = 563 

41 /B4: 3E16BB2O06CD00VF = S73 

41792: C3H3A12A7CA422«?4 ■ 37 1 

41800: A4ED5398A43EB5CD = 1072 

41S0Q: A09F7CE6BBFE982B = 1239 

41B16: L77CA72B13E6=0FE = 1081 

41624: 20203E7DE6E0-Eti0 - 105b 

41832; 20B63q7BA4A720D6 = 563 

41B40: CM09^C303A14F7C = 926 

41B4B: BFE607473C3C3C32 - 553 

41656; 815C216AA42323L0 ■ 610 

41664; FC7S327BA45E23S6 ■ 924 

41H77! FREWEB722E732A75 - 910 

41BB0: ft4092275A4CDl2«?F = 970 

416BB: C93A9EA4A72B46CB = 1061 

*tQf4-t TCZBISSeOteCDAB^F - 622 

41904: 444D3B3DCEAe9FCB - 994 

41912: DECD929F3C3DCDA0 - 1219 

41920; *KfrD2BB:sCEB*?F3C - 763 

4192B: CDfi09-CB5e28B522 HHft 

41936: B2P4 1 S0CCB482B05 - 650 

4LV44: Z^bUf44LUUJ^2/tn4 = h/ J 

41952* 219EA4353E0C32B1 ■ 661 

41960: 5CCD129FC97CE6E0 » 1233 

4196B; FEA02B0B0630CD0B = 727 

41976: ABCD129FC303ftlFE = 1135 

419B4: E.0201F0630CD0DAB - 719 

41992: 3A7BA43CFE0AZ006 - 707 

42000: CD009FC303A1327B - 896 

42eBR: A4^F0C37R*rirrni? a 7^7 

+2016: 9FC9CB7C2E0B0630 = 792 

42B24: CDBFAaCB129FC3Q3 ■ 96H 

42H32* fl 1 3a<?£A4A7 200806 -> 757 

42040* ZBCD0-AOCE129FC3 ■ 997 

42048; 03A1E33E06CDAB9F - 985 

420S6t TCC lFS0fi6eCD0FA0 - 10B4 

42064: F1CB572B0322B2A4 ■ 902 

42872: CB4F230322B0A4CB = S54 

42080* +72S03227EA4CD12 - fail 

420BS* 9FC303A:00 = 518 

p fogra/n Jf. 

c S6H ■"C" 

13 ;F k . ftfiO T4CW J.ET a *999 
IS I FT i E-STRI a 

14 :F _EH i» 3 THEN LET t *=" ' 
liC GO TO 14. 

1= LET P«4.. IF . .20 THEM LET p 
wt 

t s fiETTJ B M 

13 LET a-PES^ *^&9Sir£56fPCEK & 
£09? 

II PPIl1T ,: 'cT ,, - 
HT . : * 

£6 RETURN 

315 LE r asP-EEr 4£3B^*355+PE£(4 4 
.-C;S 

Jg ,:■- Jug ta 

:*4 psj MT p- - £0i pqpER p r eax 

iitt" 1 1 s 
36 h= !UKr; 
iS LET a :PEEK - £.20 Q 6 +3S S * PBEh -t 

£e&7 

42 SO 3UB 10 

44. P*IMT AT 15,9, FflPCC p, c -_ 

ChT l,jt 

4B FETUP!- 

50 LET ■ «PEEf 4&39l£. + a5t?*PEEr' 4 
EQM 

53 50 5i_r ll?i 

54 PPJMT *^T 15^83 PHPfiP p, SP 

I0MT :; it 

5£ r-ETuPrj _ 

70 LET w«P£F- iSitJ""- l,E** ; =PEC 
I- 4£i42 W ET ■ -PEE> t£12± 

75 LET ll.'l.-L' EMP - , tUSS/EL 

74. 1^ ■ =0 FMCN GO ~0 =0 

76 LET ;H6i «STp* u. IF u=l TH 

EH LE~ t3 IS TO lei 3"L02 " SO T 
,i -- 

^f L£ T it'i ~0 ie)=LtHli ' bC 

SB 
?0 IP ; s0 THEM CO "*0 S5 
Z2 LE _ n-r =*TF5 ■: IT :=I r i- 
EN LE~ i*(0 ~0 l£;c"CPEU " GO T 

a 

se p^iht ht et,c; ph=ife:p *.j BS2 
UHT 1 **; l 
2E PETUP:i 

:oo ;: suB to 

IDS LET s :FE£f i£SC .^Sf =EE 

::oe PRiri- rt si, Si f^sf 4 b 

EIGHT l,"*iCCRE FP;»iT AT 2 

1.30-LEN J J n* 5 PAPER 4. BBI^-*T 

l;i 

iOi :r r« mr , gj sue it 4© T 



PflPEB p BPI& 



18& 1= j«S THEN 60 »U6 30 Gj - 
ill 

ivo i* j»i* rnew ag &ub *w i*j i 
: in 

110 IF i«7 T »V- G3 SUE 5C- 'il - 

Lit 

b +(S (50 iye 5-? 

Il_ pflNDOMlZE --3P il519 

= tfCJ lET .=PEE- i3B*i 

COi IF jmS THEfJ CO iUS ze. 92 ^ 
O ill 

£QA IF j=& THE'-. QO SUB 30 GD ~ 
111 

SBS IF .-JO T4CN S3 JUE n, JO 
TC it* 

£06 IF jxi3 THEM <3j 5UB 5« :: 

SIC I F i»li T«EM 57 SMF ?*• "- 
TC ii4 

= i£ If j-J THEM 55 T"g 6ie 

el* if .=£ TriEr. sa to 3?e 

3Q0 PPlNr at ^i o paper t; en 
CKT 1 . *MOJ BEP5E&S h 
90S IF TJKr.'*- "" 7HEH SO TO 2Q 

: 

30A IF X-JKEYts " ThEH GO 70 M4 

306 LET ilcINUrf* IF ;i':"h- - 
HEN 50 TO 30H 

UUb VKINi ui «i if ^HPt*J t; EPI 
CHT Sj " ".TUB 12:" " 

010 IF ENKEVt "' "HEN SO TO 31 



JIe SO SUB 7«S OO TO lil* 

ass f :c:«=:r ^ ^et ^^pee^ ^^icc 

35£ i_£T »■?: -El r=7- I fr £«i TH 
EH lET brnkH) 

034. ir e-O TICH LET a -;.- L£T & 
-9 

3BS Tf c^4 THEM LET i=l^ LET t 

■a 

7; EftieMT li ^-^SH 1;-*" ^^Xh- 
pp,P€P - BftISm ' 0" 

360 PRINT f,T 41/0 PflPEPl t; 6P t 

365 fop r,*ae ~ci -10 a~=p -i be 

EP .0£ n ME^"^ n 

364 PfllfxT fiT 5,3; PAP- £* i- ERIf 
HT I - FOR NF Q«MF- . . .PPFS? V 

' *' 

S6r IF ZHKEY1 ^ri£.H CO TC- 35 
6 

360 IF TNKEr S-"" them :; t: ■ 

370 LET : * = INr.£Yl If t *.<-.•>■' 
HEN SO TO 366 

■373 GO TD 6 10 



*O0 PRP=R 6: INK, 0: CL; 



PRINT 
"1 NI 



1 j LS; PFIFEP 5 'TIM5EC ' 
602 PftrM T HT 9, ft; PHPE^ 5 
■ > HOCKAO^ 19; 5" 
60+ PPIMT P.T 13 ; 'JO- -RE*i EN 

TEP" 

609 IF INKE a TnCf. £Q TC 60 

c 

cCT IF r*;-.ri'»« " "HEM CO Tn -. 

cOO CLE PHXhFT ^T 2 ;."Tr,-=.'« a 

t z- f ■'■:.-. I . 

.:- --r-. T A" " , ,fl. , -UHC^H level : 
■:■ OU UISH TO PLAY ON'" 
e04 PftI?iT HT 11 £ "PBEi-? 



EP I'^KEVC 



^..3. 
HEN 50 T2 66 



eoe if inkey »«*■'■ them «o to bos 

: :c _£ _ . 5 = :'. • r i rr ,.;-; : s i 
5 OR CODE js-S; THEN GO TO 3^i 

Bl£ ^£T : =UPL il POhr 4*. OS.: 

314 ILS LET - iO PftlCjT ft T 3,2 

. ■ VQU Hft'.'E SELEOTEO LEviE. ■ : 

Slfi PftlTiT HT " 3."£Ei;--« kc . i : 
tfi e';te= *b P. = ^. .**h*»ictf t-e; 

it *- € stsft -6i» 'ivi ihfet : ; 
€. t • : " u : . " ". ' : t . 

914 PttMT AT t | * OS : ". : . 

Ti I 5 " 4 a : . - a i s i ■ r t ! J " ", , "" 

£2C PRINT ftT i"" 3 NO" PRESS =11 

TC- -:■ F^- 

C5L^ IF I-jr-Cr* _ " ~ MtH ".' TO Si 

8f4 IF rJKE^'i« '" TMErt o: TD Hi. 
&32 -LS RPN30MI3 - JSP i.iOi: 



Mutant's Revenge 



Martin Hargr&aves, 

Altorton, 

Bradford 



,:/' 



Hi IM ! 



1:1-* 



- -■■■■■■■■■"* '-- 



Mutants Revenge is for Lhe l&K ZX-81. 
I he principle ot r ie game «nues irtund the 
jtc-jJt- djtKiiC DufLtiJer UKcqM ytut art or.e of 
the ntuuntSu 

The object is to guide your nimant onto j 
hmnuio.d, capture it and .ttkt il skywards. 
Sounds easy? As you wi I (ind ouu il is very 



122 YOUH COMPUTES, VARCH 1965 



hare and will take some mastering. 

Tie progr.m itself has eveiy thing the 
mage uninpuicr ftuats :>*ak w&nte, Fostj 
original, good graphus, Hall of Fume, lOO skil 
levels c:c. 

T,ne 1 s.iould eotvain at least % full hops. 
On line 1530 ir mentitsTis 12* graph- "Gs". 

Thii means that you must typ* in th* grip hie 
U G" cliara.ner 12 tiiaef. 

Vt hen ir has nil hem kuy-cJ ir yitu must save 
befrrc run-ibg. To save type Goto 1890, This 
savts the program with the name "Mut" and 
mn» uutt'iiiuiifully on |<»4mp. There it o raii* 
able in this program oil ltd At, this should not 
be confused with the keyword At. 

When you r.m ibis pi ogr^m you/ £X-81 will 
more into Fast mode to had sone machine 
code- You do not ae-ci to type in hot n- ilurimil 
codes blindly as the program Jus tt all in 
mommy ai line 2fl and a built-in inerpreter. As 
soon as the machine ce-cc b> toatfcd tt is 
executed twice using Rand US)l 15514. 

Yitu wiL then be asked ni what speed you 
wist* tn pfay — tn 9. Not. the absence of an 
:npttt sign to avoil data entry emus. Then, you 
tre asked for 'he fuel consumption rate, again, 
Ti u range of te D and no input sign. 

Whej both the skill levels have -cc- emend 



SOFTWARE fit 



a iiea: little rouunc will chspay whtt keys are 
needed to central youi mutar.t. This gives you 
time to fumble sboji ami yict your fingers over 
the right keys, which ire; 

C = up. 
A - down. 

= left — thrust. 
P = richl — IhrLsL 

1 = hypersptce. 

Your firsl joh is lo capture a hjnunoid L o". 
These ar; randomly scattered acros* the knd- 
scape Your mciam is situated at the rar cft- 
hiMid side of the screei tteadily moving right, 
Tic and P k_ys serve as t.irust and reverse 
keys. This means rh;t if you ^rujs ytiui 
mutant vill keep moving left unless told oner- 
wsc. These features make the mLtant raort 
manccuvrafck' u^ he cor. now move in din 
gonals. I~he hits the far left fright funds of the 
screen don't wcrry as he will re-appear on the 
other side. 

When you hit a fiumannid ytiu ■will be 
awarded 10 points this wil be ehowr on tht 
"jcore" Rauge anc rre r.umancid gauge will 
decrease by out. 

Once you have captured a hum moid phase 
two begins. This involves taking the humanoid 
skyward i. Your mutant moves up automatic- 



ally so n is jum a job of i voiding p/renoids and 
:hc gati. The gate is a hole silvainl ir (he grey 
bar ni "h<* mp nfthn (fffm wHrh tnnv^s frrm 
tide in side. Pyreaoids are asterisks which float 
in the iky — -oriiaet with utie will prove iatal. 
If you manage lo rarty your buittiKkJ 
through the gate ycu tre awerded a mystery 
imnnfii nf points arid yfiii will "etiirn _ n tie l?ft 

of the screen to try ,tnd capture Ktotfcer. 

If all the humaioids have been captured yiU 
ire •■ M.I in liavc -•mipk-ted Lii atUKfe MtVCind I 
bOttuS Of 10 points will ne idded to vour HlUTi:. 
Wt.rn nil hiinlnmiHs hive bpfn rnptiired yini 
wil go «n to the attack Wave sequence. 
Sornttimes^ htiwever, y.iur mutiiit *il! ;eturn 
to Ihc Lett Ol the Screen even Though there art 
no correspond ins humuioids. In this case just 
move ihrtiugb the gat« and move to the top ni 

the scf tea 

If ycu score 500, t:O0 or 8O0 the.i you will be 
awarded an extra man and the gatne ipced will 
hoi up. The screen will dear anc another 
random lundtfipe will be drawn snd play will 

cootime. 

Thb program is lilted wilh z special key 
which ; when pressed, shoois ym out ^l trouble 
and throws your muraiv inio a random position 
tin the icwen. 



! R£W 



. r- FULL sTUPS 



10 
20 
O01OO 

E't'540 
55F7S 
PC54fl 

30 
i-S 
Z-Z 

Z m 

7S 

SO 

90 

10O 

110 

ISO 

130 

14-0 

ISO 

1&0 

--H. 

:-c 

iae 

-_<sc 

2BE 



FAST 

LET =)$-■■ ZcOcCD?3J.P3E©OC0934 

aecD= r 5oeC5iiri3':4.(3BEi506£O5isa 

p5^.0UJi50FB01B!DCH«ia4.0<»077C 

it£o=3cio:-Ecs3rrcc-r5ioissoF 
ieEe>=7cn?McCSFS3Ece3waFC t 



_E _ ' 



LcT , lC=ie5li 

:-^ -: i5- 'CCve ft» i -£; 

- ; -*5 

MC=lrZ-_ 
EXT I 
5LOU 

POKE 1&S35 .33 
POhC 4.6577, -» 
POKE 16595 , 190 
DIM LdOi 
C EH K*2) 
£Mt1 H* :i±. £^ 

r->R r 3i to ie 

LET N*H = £ 

_f T -S 11 

E-flMt' - ^ 
POKE lc*l£ 

RtH 



H.P.H 33F*'i 



5.10 FOB F-6 TO 31 

ssa if *js ftHfr F^ae then pr:«- 

AT 1MT t5nt*^-.~ .F Crf5* iSi 

sea priht mt i..F,cHR* l:.3.^t i: 

STO LET I=IHT iftHt*30- 

330 LET H:HtiIl; fiNO H.aOi-^I 

E3fl : p I IS THEN PPJrTT AT H F.l 
% i 
£00 IF I zl* ~^CH PBIH 1 ^ O" -- 
F.OiRS 13* 

eio :f F)££ =ttiZ Ht>af> csf i ^; ew 
i -.J nwo F?i =j(jc r ,oi ftwc i«j ; t 

HEN &0SU6 6 AC 
&ao IIEXT r 
&3© GOTO 670 

i4C rirl-IHT AT ii H'JU.CHHt liO.T 

AB HJ-l,Cnf:i Sjflt H-i.F.CWRi LBfl 
TAB r:CHR» 8 
C50 LET ML"»HJ + 3 

67K» ?3& F = *.L TO 5*_: f"Ee g 
&30 PRIKT ►?" ii.F CmFs :=£ 

ess Ncrr r 



7^S 



PRINT f r *£,£3; ' SCPR£=' 




31 STEP SF 

■ TIEN QCTQ SiO 

C STEP -SP 

c ThBh ----- -;^ 



?1» LIT K*<2) =TNh.E,'S 

>2l3 I* Kt i'£ i '■ ' ?" OP, K(i^' 

hfn renm Tin 

330 LIT FC^CCDE K»'t8>'-tt 

340 LIT FC=rC+l 

:>3Q LzT FC=FC.-10 

2S0 GDflLB LS^O^ 



Q 




430 FOP F«S TC £ 

430 PRIMT 5T F.e,i;f;0T F + 1*,0 * 
ft 

±i(3 fPEKT F 

450 °»IHT ^T 0,13;CMft* i5+;37 6 

,7 .- --o"- ■ up-';st a.': ft'- ■ 

OOtJM" QT iO, 7;" - " ■O — ■ - ^2F - ' A~ 



J.60 Ir- ;r,|p£-'5a THEM tOTfl 4£0 

i^B cflMO Lf&P 1S514 

4e0 POKE i&AiB 2 

a 90 FftST 

-WW Ltl L^-I4 

510 LET HU-0 

550 LET K-IS 



7S0 LET ft -3 -IN' 

73B LET DP*S 

7Jfl LET E?0 

TTO TCP &«B TO 

753 ^OSJB 373 

— O IF INKEYf-' 

— -*0 HEW ? 

TSO l£T 6-0 

;ce> e-o"ro -sa 

?j0 FOR £*& T3 

lie . • • . - : -; 

::; ;p ■ ■- <■■ 
640 HE-' \ 
5SO LET E:31 
£60 &OTO 810 
370 PRIMT At - 
350 LET PsPee- 
16399 *£S6 

640 IF FU -O OP P E fiN;> F- 
ND PitlSS - HEH C-3 T .^ -io3 
wyt) 1)- V:Ut) fHfiN GOTO a? it 

510 if ny=e »W' -*o -he?i soro i 

14<? 

a: Fir, :riPi - 
^;s _E~ B --=L--C 

*aa LET (a=a*ilrjKEY4; ! fi mHD fi 1 

£j -IJ'iKerii 1 J- AND CAmC' 

•3« ir iKtca- i- theu 00-rL.e- 10 
00 

37Q 



PEEK 1Sj56*-E^ 
tl58 R 



ETURi; 

ET MUbMJ-1 
OtO 7QSUB ll*il 
0-?Q _ET 'lrt= i 

1O00 _ET a-&4io 
■tO.0 ^BJNT-RT ft, Ei, " 

.S E5HT R.B + J. S* 

i-320 _ET flift-J. 

1Z2C ^?R A«fl TJ C STEP 

■ | ■ Z- :-.:..« 

1050 i_ET EsE- ilJKEvls'F- xnc E ; 

11- Ci**KEYt3"0" ^NC B ) 1 

iceo rniNT ^i e t- i^HHk 

El'lMRJ LSfi.fiT R.B.Bf 

i^ -,i i i- i n-c^ r ■:.■-.[• o 
iLiod ir : a -^e; i EOstW 1 120 

109B fJEXT 1 



B";rt ai,HU* 

jE2 .26:3:PT ft 



5 = 



1100 k.ET 5a»f54lfrr !R*i£H 

met ^nrr 71 c 

lie© LE7 3 -INT 'F,HD*a7l 

1130 RETUWN 

1140 RP1D U3P ISELA 

1150 PRT.NT 07 ;0. 3 
l-U-J'Jl 

■1 TC 40 
11TO NEifT F 

1130 IF 5 300 CR 3.50O firJD i .£03 
TMErt GD3UD L2£fl 

•xaeo let nTsqT-n 

: _ . '.> . ■ ' ■ *. ■ « 

ISiSO F0= F-O t; 43 

ii30 CPItJT «T 14^10, "B ONUg LIFE 

.=^e _et _:-„!,; 

:a60 <_ET FC»*C+0,3E 

ii7C RETURN 

1380 LET Ll«-I-S 

1E90 FOP F-l TO 11 

1300 PPINT " F-1,0;n*(H,F. 

1310 NEXT T 

132Q FRItJT RT ei._Ii-ll.BS 

1330 FOP F-a TO 1. 

1348 print at r.e;B( F «T a,e chp* 

130 
1330 NEXT F 

12BB ir ^;-c TnEu asrs i^ae 
137B IF CH-1 TKffN GOTO 930 
138 B GOTO 630 
1230 PRIN T R1- ►! O.BJ 
:jOS LET n_3.H*T ifJHCiVf 
141Q LET 6-IHT IBI40*311 
1-130 PETUBh 

1430 prim- RT ;q,ii;' l E-S-9-E£ 

1MO FOR F-B TO -10 

1150 NEXT F 

146a POND U3P .&S14 

1470 POKE 1041^. a 

iaflO por J=l TO 10 

1490 I" S-'-L'J' rWO 3>a THEN GO* 

ST J?30 

itrao if Si-ucjj aho S>3 then got 

J 1710 

lt_0 Mfi^-T J 

;?^0 :ls 

1E30 FPIhfT HT £ 9; "HALL CF mfZ" 
;TRB 9: "IZ^GPflPHic 0" , , . "PLRCE" 
rftD io i ■■Hflpic .'an e?, "it.pc • *- 

io.13. I' " Tl PLBV.TflE 3. ■""*_! 

"' T_ FE5ET HIC-M SCORED ■" ,TM _ 

... 3 ..„ To cHfl^gF DIFFICULT." 

154 fl FCP. J-l TO IS 

i?S0 PPINT hT J+6.2,J,TRE 6.N*'.' 

I .AT J46 ,23fL lJi 

1560 NEXT J 

1570 FCR F_ L 1 TO S3 

1500 PLOT F.5 

1530 FLQT F ,31 

16O0 PLOT F .34 

1610 NEXT F 

_._*0 ^CR F-e TV _* 

1.30 PLOT 11, F 

:b4.0 Z^lT S2.F 

16SO liEV- F 

l-tJO CHUT ^T *t,"(iN rtTTftCt 

E "iRT;" /Oi-S r3CREs":5 

1670 IF 1JKE.'*-"1" 'HEN GOTO 360 

1G30 IF IMKEY*^"_;" "HEN GOTO IE© 

l£ftO IF I*£>i- _" ~MEH ftOTO 310 



(continued on next page} 



VOUH COMPUTER. MARCH 985 123 



Grid Challenge 



SOFTWARE fit 



Jcttn Consarttne 

Swantand. 

North Hurrbe f side, 






■ -. 



I^GBin Challenge you art showi a grid of 
19(1 slots eich referenced by a letter md 
number. Each skii w fi led wiih; one ol up to 39 
different characters randomly chosen and iben 
hiddp^ from yfmt virw 

The object of the gaaic is to pick two march- 
ing charities. Tf you are successful you arc 
allnvrd ;nothcr go Tim eonlinuus until /ou 
make in error when it is the comTruter's "urn. It 
is fl1irw*d only hi** mm as i- fl«s (he answer 



fnnni-nuptf "rem Avttouf ,p-fej*l 






1700 GOTO 1670 




1300 Lrr Ni<p + i*iNi tP! 


i>ia Gosua is**o 




1310 NEXT P 


L?ee PKHT ffl* 4 , fc, "UELL L-yhj; 


►*LE 


J3£0 P5TLRN 


HSE ENTER YOUR MflHEVAT ifc.3: 


'NO 


1338 OR F=0 Tu 23 


MORS THAN 20 LETTERS," 




n&Q s:pcll 


1730 ItvPUT Mf IJI 




1350 P5IKT TfiB 31; 


ifSQ L.BT L(.J) «i 




13&8 NEXT P 


17fi0 GOSkJB 103 & 




1378 C_£ 


177© aura i52c» 




1SB0 R=Tl_*N 


1730 FOR P=9 TO J STEP -1 




1390 5^U£ ■ MuS 


1700 LET 1 iP*1»:l rDi 




; i^f. P IN 



ripjhf every tunc. 

To give jrffij a fighting chance, if vol type 
?ec!* y.iu will be allowed i quick loftk at Lit 
grid at an/ time bur a check is kepi or hew 
often V3U do (Ins. Also typing Score will shew 
*our ivial Fiic-vstes jo for. 



The Jui j ii >i of iht gainc may be sr.orr-iii-'tl 
if required by reducing the values of TP and 
TC in lines lOOOtMfXHO.TI-c harder we cam: 
you choose ihe more different characters ar: 
meet Ytiur :uncentratioij will be pushed to th- 
li-nit 



jo n i.t»i>.t«<»*t« 

,y l»t i-K J li I -l"l H ■> 

iff kfctt J. CCHS'M'HF 

jf ItntKliKMttlllX 

ll)0 PI >*'.<£IV 3 C, Ol ■ J* , 15> ,»L»*'-(e 

I t¥ XLU'l" IORi*ltft?S ilMif M-Ji?l HBX* 

lM JWt*-IT"FCm"|T(i7t9 I'l-ff-yVI NSK* 

«JBtt*« J *■*««■ I T',fl9 il«n--*j '■*-* -.■-■*:■- •- r 

i H ***- 1 z;«45s~ ■-? : ? :-■*■ < * -vi ,■ •*-. ? : ; 34'< * ^»-i j *-*» 
i*» ii»-"ii!i4M*g , 'iii-*3;r(n**i-v i :-j4M*w«i3f"" 
i K :tf ■ , iajM3 _ B9X""rts- ; -->"*"w ■ t-3+»**»ii j»^ ■-- 

I4« prj»-"*Tt«f K+! ;?.:T(i|Yrtf*«]Pil 1 1 i3*l«*F5<[ ]" ■ 

I-WI -.*«••* ■ 

L« f^TFia IfB-:NP!Jf3i)[fKMAlvt:-B»IIE»<4-H*tE8T:":W 

» irTuuocrij.'*rMENi» 
:w <miHi'Houm«[iu »ic! F">* uk* «M nnst. ■ 

i«? XQ4««9» - ■> IH i > C*r<tl.- '1 > *FC-'T«r,*f- 

i5W ffHT"*H| *HW1H H -- P^|NT(. QCFGLiB?««» 

rt* ^"JITtetl^MT'SBPh-H,' 'JJ 'IKST---- FL*I GO3UB40W) GOTIUB4 

/t« 'KIM 'Ml OC F!«T-.-- :iwJ--OCfi«JIf»»S 

?■» ■•Kim-TTH.F'^-F UT1 - " 

<»7 *K"l*t»»»*»*» , *" , **l"» 

+m *sm sti uf on mfipi' 

*4* jasjre^? i - l 

JIB FWfl»i F tW". r-gKjs«lHft1S 

■:: «'rl t fiitini.: '•L"",- > 1 

914 |FL-iefh*pr. -: ■ J ifiiir:4 , i 

»S7» ?>-M -ll»tMKW 
Y» «J*0»W 
V«9 *.*«'■■ PP>- 

«« rcRM-irm-- 

tK 1FnM"MNB*-n3»*<rtH.*,|i 
134 iF r Tu.itH;N?»i=nJ»»i;Sj* J j< i j 

!B# |FK"'SIHH>HBWlHf<«i..>|.ll 

J19 > "L-*1-»HH*-iin*i ti/i * i< 

(*5 tD-^iji^iii-i; 1 ' -~h-h*' (ro«?-'-i ■ 

it)* URN- 1 f^N***! 

1» (*TF*r* 'l-lr-l-Jti 

fW '*-C»-?T 

»«f 1*.JC1 PFT1,R>|I 

Iff/ KIWW •«•*«»<*• 

'ma m nipw neiicji 

JI"Hl< H*»" - " 1»I?>» 

iAim hiKFPi'm ^» -MpB^Li* r»<rt»».vl 
IBZB np*. HIHI '^h wta««n 
imp r ,i-i*ree*vi 

i^'jif tF^i rw**UT9?i ii,i 
j in 1 ■ i "i»- • *f *t ^+p-* 

;«!' Wt»TEi. '(*3H I. . Tr 1 'MM. 
*«iv *W!liHBI3Ml *l»!t-T' t'l*/ 1 " 
;PWI> ins*-'.* ■■■ r '- l4Mrv 'ft-t 

,!(«■' I H»^- 1 1*11 '■(.->> .• M- ■«* I liT'l 

,vii 1 i-««=^mo*i>- It • ff ■ 1 41 f^v I'lil. 
t V5« IfB^WWDi ""■ " Iflnftlf MTtt, 

i"*M f*!l'1-T -i^J-liJI ?M*n»" '-(-jf IV — -* WH'SJ«ft« 

;?!»a Rf.fi i- i-H' ia ^set iht 

i)M! MW"I1 Of -',ik*j|T«I5 
"! ■ -- i - ■ — : - ■ ■ •! H-IUT* 

.i .. h-- '-r r- : -'I- 

.. ■.• "--if i^V K)t.ill>HD t'WJIWW 

Jl-.M"! t* sw-^hip- '■•■■'IBHC IB : ■■ 



■«<f» nsn*H 



MS ljJ^*MH 



i iff !'* S1K.L ptlHMfflr 1 ' 

MvU WW III 'I B-'TTP? twirl Ni< 
E Hf ItVtL I**! SJt B*T Ft* !-0Hj ' 
*:»." St "KhU KJM Mil I'LL ■stT*' 11*1 



-MP* Kl ' [1*1 I1CM 1'lVMfi*.. 1 (.«' 
ilW fE11<*i-»+*»»H »»!»»»•»»»»«» 

^'c'f" FQc^ii+j-J'i* '■fur/- 1 r in * 

&M \W*t<y.,1>*m<,tl .iirtNi'- nv.K-« r«l*( 

.V3« MEKT HFj:- 

iVA X=5 V-T QOSIittSiB rjfjsijtreiJt 

3?3* DD5ii.JB?lS<ie n.»rL*l Hfr&.l.J*SP' i«<'I.VJ»!*'f 

S«4 GOSVUIUHVU Kt>[ ,Hti>. HilH^LD^E 
m<17 (FKIUtlllrtta 
*M« NEH PLfKC»4 W 

m fkiktc* i»»y-. i i-j»y]Lif h y^»«t ^»"-li3 etc »■■»■•<■ »* hi*^ 

3TS3S IFBJ-"*lW««f**i 

«sii irii-'ntR. i MLn.iisumnai - m™ if \muifii.r K»***r'i[l"03*B* 

JSS3 !h*h-|iKET*UnTE».-"y**l<i' 

»J4 Jhf^.jni;Hi'l]HT r f. H l r UT TUTU 

:*eS5 ]f»Hw[fiiMt:HH»tHTE*.- | WX hWil h4ivh- J NMn Kmiw-.-" 

jtut LLisuKw^w^jiffesjee 

J337 IFiJ-'Si:tr«rf;'THH>R]MTEi."BLl-*fi VjU-T'TF'S PfJ-BT'TC IKlBliJMBWl [>g-03B*B 

J3»P U*"H3«<1». . ■ L t >-L-() F'-Rn-ITOM IiFj*»Ml n*«L* .h.. I THEMfL-! iWUfMH 

133V 1EX1 [FFL.-«*Hi't|«HIH 

Tie* SWVTL'PIIKTU- 4." * l-v',irjpv;isTHtK]iiW 

30<ia W(*-«»*V »(■<■*>*■ JFP» «K i V>»SHTHfc-JW» 

3B*»o«surw*« 

'JOT "Sll *EI lKP*l"k->l>-r mCTHE*> TO fHKI IB H 1 B J' -1* 

Jim im.i.'i'ii*nw^ 

til* J.*f iut'a».. u n.=a foni=ifi5« IFJi-M!t*"|-.f -rt. l:lHt-»*L*l HJt rt-3fi 
3l?S <rtxt tF^^'HCHNpH 

JIM ^-v»-L(niD«(*..2;> t=-v<itiwwj.|5f«H»i» 
3] 48 jih.Kjyiv |F*«i.»; i- j -if » i »-tH3wg 

J] 4i [ tXwj'^Mf-hvBwvTri-k^ft^ft 

J36a [^ : Pll!>^^(.yl';^^t^:(■;.¥)^HJE^p*]^TF■i,"*THE l f ibtdi ! ■ ■■ ■ Dpsus5*pe iv- 1^*1 

*3«3 ['hi. -„-. >-')-i>»^.V.iTHEKjU*UilJ«»¥ei MlSK. Vj^Pf OTSHISSrB PI*— I 

jis*i in-p.i<htHftfiei«i:x-(.y*rjiHp* «txx.y«w ooguflseaB-oaTQj&oir 

}I7D ■»! > TCf , ■" HO Hpir;.. :■ : _'.' i Jtu«i rjsijf.nea K-!lKTI«TF,nil* . . 

1J72 «I«K> ViW Ml«JIBi••:PBlI^^*|,HW. , '. " (1]1(!3M 

735JT Itfl llllll l 11 

7»6 *EP1 BR* (^.3 

7J» «JBPl| HHii w 

FJW4 *Hlf.T--l W B H l M |lp- -IL* 

ui it ■mhT*' i ii m ,''C*B« ■?■ *i-T»»-3-Hit*- 4-';jt»«-s-'Ot*-*t*-eKf*7'' 

93*a -»]Mii*tie ■-!;/*< ■?".i>'i*nie-*cn*F-nt--ci | **" , iii" 

S33« *t3^^ t tt■»l|I J •^*«* J BI4'■^CI•»*-HIBl- 

w« "RihTsst.-i'LL. le: v:u wve n euic; ksek pit the wta "j 

B-!?7 *HI!P>fT»Pl rEEFI t: VCEW WD TIP*." 

eiae 'a*j»-jTta4 itni^iToca 

ei;e iqsij'«s pFr-iTwi;-ij».H*;)r.yj Hhx 1 "«:<■! 

mi* '0**-iii:2# nmv"i i m a 

m 1 3 iKNifM.>>>sr*Ti(r«09vnB<»«>-iiiw)» 

0114 J(Hi«lK« J-*|HTrfr»;>i*f P -,- 
WVi-B *H1 P-T>T NtTiJBV 
8MB 4-E— HMPl PCHO < • > > VETlHH 
WFB rOVITCiSH -tm ffiTl*W 

WBB IETBB IBM* ' 1"tM!C<JB 

«1* <E1JW 

4MB lUSt»lBffl P*»!NTl*»..wD»,H»'K f- IftTuFH 

ivuiiu Jt l^„->/-TH«IIP*rWT>;#; "flu Cl**101 JCflT HE rtuj. ) "1 1ilj hm PhtPJJ'' S3SuI»0tw 

isaea \* ttyf^Hf.hitBut 

1BB1B UfTFJUiThEHPBIHTEiTS-WCU HIM HjPTTlM »1l THIS TlPltl " ■ DCSUUBBJB MTJIBMB 

3 WW WU*N 

IteO* BfHHT-HMiW L5T5T WIS TJPfl ■■ pO'dlBll-w 

jiw*v r* mi *;mmbt5es vow no* f*sj$ tint, •- 

■ B« MUKT-JITht litUfES MERE-— - 

]••« nton-wrtu rTr-Bpr-iPfi* <»/r ym Ftii3'is-, i e I -Tf«B>* 

I««70 fftlW-H B'li.-'*PTJ|Krf,- 

ibvso BumT- fmr iiiiHHi ir** w^«- 

lf«» 00»J»KM .«■«■--*-. MftTHiH* 
;?]U>" :H*C -rT-lFl'lu.'-i- 



Fragg Chase 




Lt'fon, 
Bedfor*t$h',re. 



FRA(j<i ClIA^F ts f*a»ed rn the popular eamc 
Ziwnbii-s. A i ihe stain of [hi scam; t'Out pby*r is 
ar rhe centre of :he scr;en A fra^g will aruck 
yo-!. 

Tn survive, rhe rriRss must he destroy -J. Tn 
destr*>>' Iract? you nua lure tiern nrin the 'ed 
acid pooh. I ; or each ffBKB yt>n destroy, 30,001) 
po nt s will Ix awardi'd "The mid pool;* are .10 1 



deadly 10 you, bui 5 s 0OO pom is wiD ho (ojt for 
each c hi racier -sixtd acid pool yon crois. 
Wlwi- all ihi fr-^-gs are dtttroyec, or if there 

nr<- n-infr irappi thin you cat handle, lica-J Tur 
tie idgt of the s:rccn P Reaching the edge i& 
worlh 30,01)0-50,000 poi.ns J spending on how 
last you were rniivinEr on arrival it tie «jRe. 
When ymi rearh the edjie of the screen a new 
r*mril will start with one mnru fraup than iK- 

previous round- PecniK ft^gs pix la*y, sonr.e 
iifl hem donor materialise in every round. Tl:e 

rru\ mum riunber o: fragg* pmsihk in eidl 

r>ur;d is displayed ut ihe rwiitom of the screen. 

Tf i rr;ig| , r|i*«itrD''s you, a ojw name vill start. 

Thr highest snurc =.mcc he pr.tgrjm w;s 



kucled is displayed at the top left of ihe screen. 
The game will increase in speed after each 
rojnd wan. The maximum number of fraggs 
:iviil:nic is ^O. If you find The pame ton easy, 
pr^s the reset button and type: 
POKE* 2F71 ,# EA PGKE#2P7£, 
* = APOKE f» 2F72* EA:CALL# 2FQ5 
and pres: Return. Thcgiime will now bz twice 

OS. tin:,'. 

Tnt arrowed keys on cilher side of the space 
bar will move the player in dt dnecinr. of the 
arrow. 

1 Ty*x* m the propran as listed 
3 Typ« Rur and press Rsturii. 

3 If ther- ate no error tata a g m thin :epbcc 



ia-a YOUR COMPUFEP, M4HCH IflflS 



* 177B in line M with # 377C Run Iil- pco- 
gram again, If 'Out of data in 10" appear* 
on ihe screen then Goto paragraph "5. 
rf an error was logged in pais 2, you have 
missed oat s.ime (Jita ttaltmtms in 'he pnv 
grim. If ao crrcr was logged Ln para 3, yon 



SOFTWARE/^. 



liav:- scmehov typed in toe much data, 

W-nJ line 10 to read as per the listing and 

■ypt: 

C5AVE"F3AGG CHASE ",A#*2Ft5, 

E#377RSJUITC 

Start tassci i e machine recording, wail 10 



seconds, press Return. 
7 When program b saved type; 

CLOAD' FKAGLi t;HASb ,S,V; and press 

t Rewind cassette and press plcy. If any erroTs 
aie reported then repeal from pira 5. 



Ill FORN=*?FK5Tn*377F;RFADDsPOKjEN,DsMEXTN 
lfla QATA234, 32. 173, -0,32, 9,^9,234,234,32, 134,34, 32, 28 
9,91 ,32, 18,49,32 

1 1 9 DrtTftl , 48,234 , 52 , 1 Tfl , »,32 , 167", 311 , 32 , 30 , 53 , £3-4 , 234 
,32, 167.30,32,101,54 

1 20 DATA32 , 139 ,34, 31 , 2fl , 4B , 32 , 45,5 1 , 234,32 . 79 , 49 ,32 , 2 
14, 52,234 , 334 , 32 , 1 15 

13B DATA49 ,32 , 9,4?, 32 ,43 ,30 , 32 . 230 , 52 , 32, 133,39,234 , 3 
2,61,33,32,14,33 

1M MTAI69.1 .141,79 ,2. 141 ,78,2, 234,234.32, 131 .31 ,32, 
27,51,32,167,50,32 

130 DATA1 S3, 51 ,32,53,32,234,52,9,31 ,32,172,33,234,234 
,32,214,33, 149, 0,141 

160 DATA IBS, 2, 52, 13 1,5:, 32, 27, Si ,32, 107, 50,32, 133, 31, 
32,33,52,234,32,9 

17B DATA51,32,:72,33,234,23*,32,62,55,32,46.55,32,180 
, 55 , 234, 234,234 , 234 , 234 

13B DATA234 ,23* , 1 73 , 1 2 , 1 31 , 20] , 1 ,20B , 6, 37 , 183 ,52 ,76 . 3 
3,47,234,234,234,162,0 

1VB DATflief ,B, JOB, J4I ,1,131 , IS?, 1, L5B, 141,2. 131,142, 1 
4,131,32,161,49,32,225 

290 DATA49, 173, 152,49, 141,228,47,173, 153,49. 141,221,4 
7 , 169, 42 , 29E ,83 , ID? , 200 , 

710 DA" A 1 69 ,2 , 141 , 1 2 , 13 1 ,234 , 1 74 , 1 4, 151 ,232,232, 236 , 9 
.151,209,200,173,12,151 

7?" nfl-ft?rt1 ,2, 208, A, IS, 203, 230,76, 3**47, 2S4 ."7A.94,47. 
169,127, 141,12,2,1^9,0 

23B DA"!! 141,0,4,141,1,4, 169, 10, 14 I , 106, 2,96, 1 69 , 147 , 1 
62, B , 1 57 , 1 6B , 1 B* , 252 

240 DA - A224, 240,230,240, 162, 0,137, 132, 18E, 232, 224, 240 
,208,248, 162,0,157, 136, iB9 

230 DA~A232, 224, 240, 288,240,1 62, £, 137,120, 1*0,232,224 
,240 , 70B , 248, 1 62 ,0, 1 37 , i 04 

250 DA-fll 91,232,224, 120,206.243,169,22,1*2,3,157,72,1 
88 

270 DA"Al37 , 1 12 , IBB , 232 , 224,37,200 ,240, 162,3 , 137 , 152 , 
183,232,224,37,206,2*0, L62 

230 DA"rt3, IS? , L92, LOG , 2X2, 224 , 37 ,20B , 24B . 1 £2 , 3, 1 -7 , 23 
2, IBS, 232, 224, 37, 208, 248 

290 OAT A 1 f.2 ,3, 157, 16 , lfl9 ,232,224,37 ,209, 240, 162,3,157 
,5*i, 1H9. -3.^7 

3B0 DAT A224 ,37, 208, 240, 1 62 , 3 , 157,96 , 189 ,232, 224 , 37 , 20 
S,24e,lo2,3,lS7,l36 

305 DATA1B9 , 232 , 224 . 37. 2BB. 24B, 162 , 3 , 157 , I 7ft 

310 DATA1B9 , 232, 224 . 37 , 2BB, 24H, 1 62 , 3 , 1 57 ,21 i , 189 ,232 , 
224,37,200,2*8,162,3. 157, 8 

520 DATA 1 90 , 73? . 774 , 37 , 2KB , 740, 1 62 , 3, 137 ,40, I 9», 232, 2 
24,37,20B,24B, 162,3, 137,80 

330 DATA190, 737,224, 37,208, 740, 162, 3, 137, 120, 190,232, 
224 , 37 , 2BB, 2*B , 1 62, 3, 1 57 

-sin nflrflite, ito.zs;* , zz+ , -7 .ren, z^u, i&2, j, i j-,zm, iva, 
232,3:24,37,209,240,142,3 

330 DArA157.24fl,19B, 232,224,37,2*8,248, 162,5, 157,24,1 
?l , z:;,r^«,3- 1 zaD h 24D , 96 

360 DArA169.0,l41,275,?,72,l6,24? 1 9o,169.l2, 141 ,B0,lH 
1 ,14! ,01,181 ,]41,B4, .HI 

T7B DATA141 .fW, 1H1 , . 4 i ,91 , 181 , IA9 r Ifl, 141 ,W?,\P\ ,141,8 
5,101,141,86.181 

380 DArAV41 ,88, 101,14 1,93, 19 1,14;, 94, 10 J., 169, 45,1 41, B 

1.IB1 ,1*1 ,"71 

390 DrtTAlHl .169,0,1+1,87, 1B1,169.63, 141,70,181, lb 1 ?, 51 
,141 ,95,101 ,46,169,03,141 

400 0AfA2 12. 187. 141,230, 167, 169,67,141,213,107,141,23 
1,167,169,79,141 ,214, 1B7 

410 DAfA141 ,232,107, 169,02,141,2:3,107, 141,233,107,16 
9 

420 DATA69 ,141,216, 107, 141 ,234 , 1 B7 , 1 61 , 7? , 1 4 > ,227 , 107 
,169,73,141 ,220, 1B7, 169,05 

430 DATA141 ,229, 187, "76, 162,140, 142,0, 131 ,32, 161 ,49,32 
,172.49,33,223 

440 DATA49, 169, 150, 1 4 1,1 71, IBS ,174, 0, 13 1,202, 208, 233, 
96,1*9 

43B DATA16S, 141, 152,49, 1 69 ,1 D7 , 1 * 1 , 1 5.' , 49 , 96,32, 1 *. .SO 
, 173 . I M , 239 , 56, 20 1 , 4 T 176 

460 DATA2, 195,4, 56, 201, 38, 144,5, 233,34,76, IBS. 49 M 41, 
3, 13i, 32,1*, 50.173 

479 DATA 189, 239, 36, 201, 3, 176, 2, 195, 5 ,36, 201, 2*, 144 ,5, 
233, 17,76,21 t ,49, 141 

'00 DATA! , 131 ,96. 1 75 . 1 . 131 , 162 ,39 . 24 , 109, 1 , 1 51 , 1 76, 1 
,202 ,200, 247, 24, 105,127 

*90 0ATA176, 16,24, 199,2, ;51, 176, 16, 14J, 152,49,96,230, 
133,49,76,236,49,236, 153 

300 DATA' 9 , 76,244 , 49 , 23H , 1 53 , 49, 76 , 230 , 49 , 174,3 , 1 51 , 1 
72,4,131 , 140, 176,49,208 



310 Oft I AZWM, 1 ,2-1* , 1*W, 1 , l=ll , 142, 5 , 13 i , 142 , J77 , 49, 1 40 , 
202,49,142,203,49,96,32 

520 DPT A?9, 50, 160,76, 162,76, 1B5,1 ,150,93,3,150,200.26 
,185,0,13*3,93,2,150 

330 DPTA208, IS, 142, 5, 151, 140, 7, 151, 32, 101 ,30, 174,3, 15 
1 .172,7,131,234,234,234 

Mffl 0*T.TA'>»?,«l7,7T*,^*,7nfl,?' A,t3A. 1 36, 23*. 234. 203. 2 
0B.9&, 162,30,142, B, 151,32 

550 DATA 172,4*7, 234, 234, 1 74 ,B , : 31 , 234 , 234, 234 , 234 , 173, 
1 i 1 51 157 254 149 1 73 2 

360 DATAS 51, 157, 255, 149, 202, 202, 234, 234 ,208,223, 9*. I A 
9 

570 DATA13, 141, 89, 130, 169, 20, 141, 81, 130,96, 234, 234, 23 
4,234,234,141,220 

5H« DATA107, 14 1,221, 187 ,96, 234, 234, 234, 234. 234, 234, 23 
4,234 

590 UAtA£34, 142,12,^'^, 12(4,24/, 162,20, 142, 120,tB7, 9o, 1 
69, 7, 1*1,22^,2,32, It, 242 

iBH 0ATA94,32, 194, S0, 32, 236, 59,96, 32, 120, 235, 201, 19,2 
40 , 13 , 201 , 1 1 , 24B ,13,2(91 

6 1 9 DATA? , 240 , 13, 201 ,0, 240 , 1 3, 96, 23S , 3B, 1 SO , 96 , 206 , 00 
,150,96,230,01,150,96 

fc2« QATdSet ,91 ( 15B,96,173,HB.1^B, 141 ,1 ,151 . 1 73 , 8 1 . I 3B 
,141,2.151 ,32,161,49,32 

S3B DATA225, 49, 173,152,49,141,92,158, 173, 153, 49, 141,0 
3, 1=B, 234. 234 . 234, 234 , 96 

5.48 DATA1 73 , B 2 , 150 , 1 41 , S4 , 5 1 , 1 73 , S3 , 150 , 1 4 1 , 25 , 51 , I 69 
, 42,14i, 171 , I BO, 96, 173, 02 

65fl DATA1S0.141 ,42,51, 173,83, 150, 141 ,43,51 , 169,22,141 
,171,156,96,169,20,162,0 

668 0ATA1 57 , 1 28 , 1 B7 , 232 ,224 , 160, 2BB , 24B, 162 , B, 137 , 1 04 
,191 ,232,22^,240,708,240 

h/e imitiH! ,64 , 191, 141,32, -M, Ml , T E, IBB, 14] ,112,130, 
141 ,152,166.141 , 192.163 

6B8 DATA!*;, 232, 168, 141, 16, 169, 141,5*. 189, 141, 96, 189, 
141, 136,1139,141,1/6 

69B DATA109, 1*1 ,2 It,, 1B9, 141 ,0, 190,141,40, 170,14: ,80, 1 
90,141 ,120, 190, 141, :60 

■7 OB D."sTfvi r 7U, 14 1 ,2BD, 19B, 1 1 : , 34A,l90, 141,24, lfli ,*i,173 
,82. 158,141 .B4,l*0,:73,83 

710 DATA130, 14 1,85, 150,96, 169,193,141,00, 130, 169,109, 
141 ,81 ,T!"S0,9A,l7T,fl?,Hfl 

720 D4TA141 ,1{>B,S1, 173,83, 150, 1*1,161,51, 173,171, IBB, 
201,150,208.3,32,178,51,96 

738 DATA32, 101 ,230, 173,84, 150, 1*1 .24,51 . 141 ,E2, 150, 17 
3,85, 150, 14. ,23,^1, L4 1,03 

740 DATA! 50, 32, 234 , 5 1 ,76, 21 ,31 , 169, 4E , 1 62 , 1 4 , 1 57 , 0, 1 5 
2,202, 70S, 230, 161, 2h 141,9 

750 DATA 1 3 1 , 9*., 234 , 234 , 234 , 234 , 234, 234 ,234,234 ,234, 23 
4,234,234,234,173,221 ,107 

769 DAT0235 , 43,208,30, 169, 53,141 , 221 , 1 B7 , 173 ,220 , 197 , 

jf-ii.4M,JMCt,*4,l6-.,a;,l41 

770 DATfl22fl,137,l73,219,107,233,4B,2B0,36,l69,S7,l4l f 
219.167,173 

78B DATP21B, 137, 233,40,200,20, 1 67 , 4C3 , Ml .ZIO.IQ-, Ml , 
21 9 , 1 87 ,32 , 151 ,30 ,76 , 205 

790 DATP51 , 1 69 , 40 , ;4 1 ,221 , L B7, 96 , 296 ,228 , 1 37 ,96 , 206, 2 
19 , 1 87, «?6 , 20 1 , 216 , 187 ,96 

B0D DATP 173, 82, 150, 141, 66, 52,173,05, 150,141,67 

a ID DATP52, 173, 17 1.1 80, 20 1,147, 200,3,32,76,52,9a, 234, 
234. 234, 173,04, 130,: 41, 62 

B26 DATP150,173,B3, 1HS, I 41 , 03, 130,Z3£,9. 151 ,230,9,131 
,32 , 14B, ^2 , T 6 , 1 75,54 , 162 

030 UftTPB, 16B, 231, 32, 144, 243, 169, 0,1 70, 130,72, lfe9 ,0,3 
2, 1 34 , 230 , lo2 , B , 202 . 208 

64D Dft1A255, 1»4, 170, 232,224, 0,208, 237, 169, 3, 162, 252, 3 
2,144,245,96,173,220,107 

«S« USIPl1fl^,ji,2l»l,3B,l6,*, 141,220,107,96,233,10,141 ,2 

20,: B7, 230, 219, 167,: 73, 219 

860 DATPlu7,2ai ,58, 16, 1 , 96, !69,*B, 234 ,234 ,141,219, 1 B7 
,230,210,107, 173,210, 107 

070 RATA201 ,53 , 16 , 1 , 96, 169,36, 1*1 ,21 E, 107 , 96, 173 , 152 , 
49, L41 ,211 ,32,173, 153,49 

Pflfl r»TA14l , 71 7. 52. 7A, *,*»,!«, IA0,4X;141 , B3, I H«5,7o, 12, 5 
3,162,7,189.8,132,137,217 

090 DATA10T,2a2, 208,247, 162 ,7, 189,7, 132. 137 ,235, 167, 2 
02 , 208, 247 , 96 

900 DATP234, 234 ,234,234,234, 159,0,150,141,1 ,151,109,1 
,130,1*1 

9 10 DATP2 , 1 51 , 32 , 1 61 ,49, 32, 223, 49 , 174 , 1 1 , 151 ,76, t93 , 3 
2 

920 DATA234,234,234,Z34,234,234,234, 174. 1 1, 1 = 1 ,'6, 46, 
34,234,234,234 

1 SO LWTRZ34 , Z31 , Z34 , Z3* , 234 , 234 , 23* , 23* , 234 , 1 T3 

(continued on .text page) 



i'OUR CO WPUTCR MARCH 19B5 125 



SOFTWARE /#. 



(continued trorr. previous pag&) 

940 DAT14S2, 138, 141, 53, 33, 234, 234, 234, 173, 33, 138, 141, 3 
9 , 33 , 234 , 234 ,234 , li9 ,42 

938 ElATfiMl .0.0.9o. 169< 14, I4i , 1*S, 191 , 141, 183. 191 , 1*1 
,129,187,141 ,169, 187, 16<r 

969 DATA7D . 1 4 1 , J 6= , 191 , 1 4 1 , 286 , 19 J , 14 1 . t 41 , 197 , 141 , IB 
1 

9TB QATA1 67 ,!&<?, 82, 141,167,191,141,207,191 ,141 ,142,10 
7,:41,lE2,187,149,tj5,141 

9BB 3ATA1<,B,191, 141,2BB, 171 ,1 41 , 1 43 ,19?, 141 , 1S3, 137, 1 
69. 71, 141,16V, 191 ,141,209 

998 0ATA171 ,14^ , 1*4, 197,1(11.134,187,149,71,141,170, 19 
],14i,2ib 

IBiSlfl DATA19I,H1 ,143,107,141,185,187, 1 D 9 ,39, 1 41 , 17 1 . 1 
91 ,169, S3, 141, 172, 191, Ml 

1018 MTA212, 171, 169,67, 1*1 ,147, 197, 141 , 107, 1B7, 76, IS 
7 

1028 DATA:5«, 23^,234 ,96, 175,9, 151 ,24,74,74,141,184,53, 
169,21,233. 1,141,118,2 

IBTB IWTft'. > J.i 19,2,201 , B,2BB, 249, 76,234,234,234,1 73, B 
3, 15B, 141 ,212,53,234 ,234 

IB4B DATA234, 14.9,22,141 ,0,8,96, 162 ,8, 1B9,B, 158, 141 , i , 
131,159,1 ,138.141.2.131 

10SB DATA142, 1 1 , 151 ,32,161 ,49,32,223,49, 174, 1 1 , 151 , 17 
3,102,49,141,2,54, 173, 133 

1068 DATA*9, 1 4 1,3 ,54, 71. lfJl. 54,169,22,141, B3, lH9.lfK, 
1 , 1 58 , 285 , M , 1 58 , 288 , 3 

1078 DAT A 76 , 22,54 . 16, 2 ,40 , 30, 222, , 138 , 189, 1 , 158 , 285 , 
Bl , 158 , 2QB , 3 , 76 ,43, 54 

1 BSB OflTflK,, .',4a,ib, *^ , i „ 1 50 , 234 , 234 , 234, 76, 239 ,32 , 1 
74,11 ,151 ,232,232,236 

189B DATM, 131 ,20«, 160,96. 254,0,130,76,22, 54,254, 1, 15 



8,76,43,54*173,211,32 

11 flfl DHT£l4i,K£,54, 1 73,2:2,52,1 4: ,83,54,173,93,189,23 
4 ,281 , 158 ,288 ,9, 32 , 223 , 25D 

1110 041032,140,52,76,46.54,76,208,52,173,2,54,141,14 

8,34, 17J,J,S*,141 ,141,54 

If 13 DATG234 , 234 ,234 , 234 . 234,234,234 ,234 ,234 ,234 ,234 , 

234, 234,234 ,234,234,234 

1120 D^T/i234, 234,234,234, 234,234, 234 ,234, 234, 1/ J.. HJ, I 

89,281,158 
1 1 30 DATA2B8 , 4,234 , 76 ,49 , 54 , 76, 255 , 53,21 6 , 51, 234 , 234 , 

234,23*, l7!t.H,1 «i1 ,56.233 
1140 DAIfl 192, 176, 3, 69, 192, L4i,3,l 3l,96 T 234, 234, 169, 1 

,141,12,131,94,164,8,141 
1158 DATA12 V 151 .96. 169.72. 141 ,1 4ft. IA7 , 141 , 18Q, 107 , H.V 

,65,141 ,149,187,141, 1B9 
116i DATAlB7,lfc9, 83, 141, 138,187,141 ,198,187,169,49,14 

1,151,167,141,171 ,187,94 
117* DATA234 , 234 , 173 , 9, 151 , 56,233, 28 , 176 , 15, 173,9 
HBO 1MTA15 1,24, 186, I 03 ,49, 234, 1 41 , 162, 19 1 , 141 
1198 1>ATA?82, l?l ,96,173,9, 151, 24, iat.,73B,161 
IZOt- OATAI91 ,2UJ,tf01 , 191 ,56,233, 18, :76, 245, 185 
I ZIP DATASB, 141 ,162, 191, 141,282, 191,96, 1£9,47 
1228 DATAl 41 , 1 e> 1 , 1 91 , 1 4 1 ,28 1 , 1 ? 1 ,76 . 222 ,24 , 234 
1 23G DAT A23* , 234 , 234 , 234 , 1 fi" , 43 , 1 62 , 7 , 1 37 , B 
124B DATAl 52 , 282 ,288 , 238 , I 6? , 2, 1 41 , * , 1 51 ,96 
1238 DATA 162, 7. 189,235,187, 157,7,132,202,2118 
]?6P n*TA247, 9*„2T4, 234, 334 ,231, 162. B t lQ^,2iO 
1271? DflTftlB7,3ci,233,23t,lB7 1 144,27, 109,218, 167 
1 238 DATAZ21 ,236, 1 B7 , 209 ,6 ,232,224,7 , 238 ,234 
179H DflTA76,162.7, 1 P9, 217, 187, 137, ?7i* , 1 R7,?n? 
1 380 DATAZBE , 247 , 234 , 234 ,96, 157 , 235, 1 87 , 202 . 203 
1310 DATAZ47, 9a, 162,7, 109,217, IB7, 157 , B, 152 
1 320 DATA28? , 208 , 247 , 96 , 234 , 234 , 234 , 23* 



Destroyer 

Pnilio Orr, 
Giengormley, 
Co. Antrim. 



■v, 



mm 



THIS FROGFAM u.vcs either joystick if key- 



board. You arc the commander of a destroyer 
snrl yiwT mnsi destrpj? the ertit^y cubouviticti . 
There Utt ibur subnurirt-K An the scrcsn travel- 
ing at dtferent sp«dj and worth direrem 
points. 

sub 1-1 point, 

sub 2 = 10 psiffls. 



sub 3 - 30 po nts, 
snh 4 = 50 po nts, 

Tlvre is also a time limir of three minutes in 
which ycu nus: get as many puinrs is you can. 
To make miners worn: underground bomxf s 
are eonsiaiit.y firing missies up tawudsyoj. If 
one rT thftsf mksilf** hits jrau then yam lose. 



88 SV1BQL AFTER 128 

98 FOR i-128 TO 14S 

IBS R~AD b,e,ct,a,4 ,q,h,j 

110 SvTiBOL a,b,c,d,e-,f ,q,h t l 

128 N£XT 

1 30 a*J**CHM I i 4D> iCHH» till* +CHR* < 142: ' CHR* (143) 

1 40 t I oudst=C^R t ( 1 441 4-CHR* ( 1 45 > +CHR* (14b > +XP* ( 147> 

150 D^TP B. 1 92, 99, &3, 42, 63, 96, 192, 8, 8, 192, 166,248, 224, 

»,0,B,B,3,S t 15,7,0,0,(1,^, l*B,233,B4,Z3Z.n, '■ , If , U , ^ , S , l'J 

,255,31 ,7 

160 DATA 8.8,48,98,244,252,252,248,8,8,2,3,7,2,0,8^8,8 

,32,lf7,197,64,S l ,0 1 13.31,a9,46,A0TSl,>S,3,l2d,ES'*,z:4, 

4B, 1 12,224,192,128 

170 DATA 144, ?6,96.24B,248, 96, 96, 8 ,8, 96, 96, 248, 248, 96, 

<7A , 1 44 , . 1 , 3. 7 ,?3 . 1 27. 1 27 . 75"l, I "S9, ^>39 ( 95 1 ! , 191 . 3BS , 2BH , 

2S5 , 255 ,8, 248, 248 , 247, 23 

9, 253, 2IS ,253,8 ,8, B, 126, 192, ft, 12B, 192 

188 DATA 255,255,127,31,38,8,8,8,253,255,233,255.233.2 

106 ,8 ,8,255,255 , 235 , 255 , 247 . 227 , 2 , B , 224 , 224, 224 , J 92 , 1 92 

, l28,B,B,B,B,b,0 T 2a4,Z55 

,233,255 

l"?« riDDE l:BORDBR H: Ink H,u:lMK 1, IB: INK 2,6: INK 3, IB, 

3: SPEED INK 5, Ss BORDER 0: PAPER 8 

288 LOCATE iS.llPEW liPfitNT "r>E£TRDVER■* 

2ie hovc 2:B,zoeiDPAU j/»,jOB 

Z28 PEW 7. 1 LOCATE 3,3: PRINT " iTqu trr th« cixiuiindtr of 

i lubnarine distroyer. It it your Job to destroy the 

enemy sub*. "i PQ THTtPEM 1 

ZZt PRINT " Ydu cartrol Lh* d^stroyar by either umi 

-»9 the j-jystick or the l*ft aid riqhtcursor key*, "o d 

rap the deptK chtrcet p 

r«ts the ^p.KLe bar or the FIBE button en th* Joystick 

."iPRlNT:PEN 2 

240 PRINT " Th» further dam the screen the Sub i* the 

marm paints you gst. ": POINTS PEN 1 
258 PRINT " There is d tine limit of 3 llnutes in whi 
eh you must qet th* highest *»ognt of points ■you c*n 

."iPHINTsPBM Z 

268 LOCATE 13.21tPRIN - "Soctl Luch ! i *. I VlPRIMTiPCN 3 

278 LOCATE 13,23iPRIN T "PRESS am KEY* 

3SB A4-IHKEY*! IF A*-" 1 - T\ EN 2BO 

298 FOR a=l TO 2biPRINTi MEXT 

38B INK 0,1: INK 1 ,H: INK 2,24: INK 3,iltIWK *,12s INK 5,2 

Hi INK 6,os rNK 7,'<.74TSf 1 ECC- IMlr; i ,1 , ia, nsd: o 

JIB P^PEfi IfLOCATE l,ltPRINT SPAtlEf (281 

328 PEN 2tLDCfiTE l,1:PRIMT "Scorei 'l score 

33B PPPtR 3iF0A *"2 TO 9 i LOCATE I ,*iPRTMr w»ACE*t2B> t H 

EXT 

34B PAPER liFCR a=23 Td 23:LDCATF l,a;PRINT SPACE* (29} 

jiNEXT 



33B Pinr 23,4B,3:CRAU 612,40: DRAW 612, IB: ORAM 23,:B:QR 
AW 23, *H 

354 PAPER 8 

355 LOCATE 1,22 

356 FDR *-t TD ZBsPRlNT CHR* : 148) t (NEXT 
JbB P£N SlPAPER 3 

37B RESTORE 43B 

3S3 FOR .il TD h 

J-VB UtAO b,c 

4011 LOCATE b,c: PRINT CHR* (271 +CHR*< 1 : ; cj ovd* 

41J) LOCATE b,c + I:PRIHT clcud*S*"HR* (22) +Chft«IB> 

425 FAPER 1 

439 CATA 3,3,7,5,18,2,6,4,15,2,13,6 

448 PCN Si^OCATC 2,24iPRlNT ' Li nw: " ; :PA»CH ftiPRlNI " 

"llfAPER ^tPRIMT EPfiCE* < IB ): PAPER I 
458 xship"?; tub :- IBt tuoZ- IBt sub J-5; eub4- 1 7: q 1 ac < =.7«ai ti 

*8: VbO*h»9i Arr^tATl «ub±»b=Ar >bcin- INT -RN3» 19} 2: ^bcrr-"' I 

iastic H 8 

4 68 sub I -sub 1 +8 . 3 1 sub2>9ub2 1 : sub 3=sufc>3* 1 . 2 1 sub A =eu b 4 - 
1.6: astlc=afltici'l 

470 IF »S*ic=5 THEN SDUHD ! .=0,10,5 

480 tf .i5tic = lB TIEN SDUND 1 ,IiB . IB, 3: as.i C-8 

490 005UB 938 

Sflfl LOCATE KBhip,9^PAPER 3i PEN SiP^IWT * "j CHR*< 1 32) : C 

HR*(133);" " 

510 PAPER OsPEN 4 

3ZQ LOCfiTE siiJl , I7IPR1NI " ■■ i tXH* (12EI |CHR* < 129 ' 

530 LOCATE sU>2,l3 : PRINT CHR*U3B) S CI-R*! 131 ) 5 " " 

5fO LBflfilt. =<J>S,lOjrRINT " "jGHR* C12B) (C*«* tl Z^) 

550 IF BUbGmb*! THEN GOSU8 1838 

S6D LDCPTE sub4 ,21 1 TR1N1 CHR*1 1 3B1 ;CPft*U31) ;" * 

57fl T c =111-1 >li. THEM LDCfiTF -_.ob 1 , 1 2 1 PR1N" - "isuHl-l 

5B0 If puh2<2 THEM LOCATE iijb2, 15: PRINT " "isub2-lS 

590 I r nibainb^l THEN 5DSUB 1 830 

6B8 1- -lubSMfc THEN LOCATE sub3. IBt PRINT " ': sua 3-1 

618 I" *Jb4<2 THEN LDZATE sub4 , 2 1 :PRINT H ':sub4-18 

620 IF INTiRND^ie^l'S AND subonb-B THEN subomb-1 

638 IF <xjt>niPb=1 THEN 30F1JP 1«j0 

635 **-INKEV* 

64B IF .ltH'fli 1 UK 1N,':LY(S'"0 THEN nship=xsh ip- I 

658 IF JDV'81-8 OR [NKEVO-HB THEN xship«iiship+t 

660 IF Jav-B>-16 AMD b-8 OR At ' " AMD b-B THEN K«sslli 

(»*3i b-1 

&70 IF h-1 THEN GOSUR 71B 

(jB(T IF KBhip^B THEN K5hip«: 

|f,9P TF v=hip = IR THEN NBhtp-17 



126 VOUfl COMPLTER. MARCH 1985 



SOFTWARE Afc 



703 BDTD 4£>0 

71a ybor*b=ybt™b+l 

720 PEN 4 i LOCATE m , vtomb-liPRINT " "iLOCATE K.vaofiblPR 

INT CUR* (I 30) 

73« IF rbanib°12 AND j>=subl+l AND x< "Hub 1+2. 5 THEN GOS 

UB 790 

743 IF y bomb "15 AND ii >=5ubZ AND x <=sub2*l .8 THEM GO£UB 

790 
75S IF vbomti-lQ AND *>-*Lib3H AND M<-«ub3+2.3 THEN GOB 

UB 7™ 

763 IF ybqnb-21 AND X>-Sub4 AND x<=sijb4+2 THEM 3CJEUB 7 

■pf 

77B IF TOumb-Zl AND ?<;vsiJti4 AND x < >*ub4*-2 I HfcN UJLA Til 
K , /bomb : PR I NT " " t d =1? : y bomb =9 
7BB RETURN 

7<?a ran a-i to 5 

809 PEN 7: LOCATE x,ytaflibi PRINT Drt**<134> ;CHR*<1SS) 

SIB IF 1-1 OP a=3 THEN SOUND 3, B, 15, A, 0,0, Z 

B29 PEN 7a LOCATE y Y yh rvrh - P& T HT run** nAi ;THRtin7) 

B3B IF a=4 THEN SQIJNC 2,0,10,7,0,0,4 

B4B NEXT 

B5B LOCATE K ,ybonbt PFIN - " »J j 

Q6B IF vbo*ib = 12 THEN sub 1=1 : LOCATE 1,12] PRINT 5PACF*.? 

0) | IKWe»Scnre-l 

B7B IF ybomt>=15 THEN sutlZ"! 6 1 LOCATE 1,15: PR INT SPACE* ( 

jJHI ; iscamcvt+lll 

S8B IF yba*b-18 THEN sub 3=1 : LOCATE 1, IB; PRINT SPACE* (2 

03 ! iscnrB«KDf*»3fl 

aW IT ybn«h-Il TIICN Dub4-1 & I LOCATE 1,21: PRINT SPACE* ( 

201 ; :sCOre=5c:DrE+5B 

90H b=0:vbD(nb=<7 

71fl PEN =1 PAPER 1: LOCATE 7, IMPRINT tcoro: PAPEfl 9 = PEN 4 

92B RETURN 

930 PLOT ace ,32,1 



740 DRAW *cc,l* 

•75B acc^acc-H.P 

■7&0 IF ace< 192 THEN <?Of> 

•770 RETURN 

9BH LOCATE 7, IB: PEN 7* PAPER Hi PRIMT "SAME OVER* J FOR A= 

I TO 1 BBS: NEXT 

99Q INK B,24,6i LOCATE 3, 2Bi PAPER BiPEN 8i PRINT "Do yau 
want inD'.hEr gan* (y/n> 

1BB0 a*=LDUERS IN<EY*t 

1010 IP a»=' M ' THEM GOTO J 30? 

102H IF af^«y« THEN 290 

1(130 IF a*="n" THEN INK 0,0: BORDER B: PAPER Q: INK 1,10! 

PEN 1 1 MODE ilEND 

1MB SOTO 1B00 

IB5B LOCATE Hb EMU, y ben I PRINT " ■ j ybon-=yiom-l : LOCATE icbo 

in, yLiun = PRINT CHR*(i7?> 

1040 IF y&oif=9 AND Kbort>=K5rip*l AND «3 0ff<;-=Kshlp+2 THE 

N dcc^l?l:GC5UB IB 5 ??: RETURN 

1B7B IF nou-9 THEN LOCATE h b (Hi , ybo« = P^PEH 3 = PRIKT " " 

:FAFER 0: fbcm= INT <RND-»1 9> + 2 :ybn™=21 

LBBE RETU^ 

1H9G " 

II BE FOR 1=1 TO 10 

1 LIB PEN 7: PAPER 3: LOCATE xahtp+i T 9 

1120 PRINT CHR*1134);CHR*<135) 

113E IF a=l DR a =3 THEM SOUND 5 , 0, 1 S ¥ ft, 0,0 , 5 

11 40 LOCATE xiihip+1,9 

H5B PRINT CHR* ( 136J ; CHR*< 1 "7 > 

llblfi 1)- a=4 IHLN Kill 'Nil /,B, 1H, ',tf,B. 1 1 

117B NEJCT 

line LOCATE xship+l T 0-PAPCP 3i PRINT " H t LOCATE x«hip+ 

I.BlPRINT " "t PAPER 

J1B5 15CUT»-G 

1198 PEN 4 iybnrt=22: RETURN 



Blackjack 

David Po't&r, 

Alton. 

Hatnpshi r e. 



pmimvwffnwwTT 



■ 



HERE II :s program called Rlackjiek for the 



V2K BBC micro. This program tllows the 
user to pby thr COti piUt f hf a game of 
Pcntoon, The aim of the game of course is to 
mike your cards tota 21 or as near that as 
pcssible, Ou' without exceeding yon bust. 

You both start vith £1U0 and whin yaur 
liist card i.-. dv;ll »ou bel on it, and smother 
<nre U dejli. Yon ctn tricn stick with what you 



have got by pressing tht space bar, c twist to 
l*:l jncther card by pressing the Return L«y or 
buv another card, thus increasing your stake, 
by pressing R. If you go bust then tic 
romputer tak*s jout bet. 
When you stick ne computer iheii has its 

go, mi J depending on lliii value of its cardt 
ion eiiher win or tose that hand. 



Dischfack program 1. 

iOREM Blackjack CO David Pot-pr 
2B»"V555 

30EMVELOPE2, I t 0,0,a f B,0, 3 T IB, ,(?, -2, B0,0 
40EMVELOPE3,l T 2,-l,B,20,A0,a,l2i,a T B,-l2t, 126 T 
30Et4VELOPE4, Z, B, 0.0,1, 1, 1, 120, -5, -5,-lC. 120.92 
60\>DU23, 224, Q, 28 ,28 , 1&? , 127, 107,9,23 
70VDU23 , 225 , B , 28 , & 2 , 1 2? , 62 , 2B , 8 ,0 
Fi0Vnil53,?2A,fi4, 177, 177,l?7,f.7,7F,R T 
?0VDU^3,Z27,a T 28 T 62 t 127, 127,127,28,62 
100VDU23 t 228,l,3,7,15,3l,63,l27 f 2S5 
1 V0VI5U23 ,22*» , 1 2B, 1*2,32*, 240,240,232, 23 A ,255 
120VDU23,230,233,127,63 T 31,15,7,3,1 
130VDU23,23: ,255, 254 ,252,248,240,224, \97 , 12B 
1 40VDU23 , 232 , E , , 1 3 , 13 , itZ , ii3, 63 , 63 
1 50VDU23 , 233 , B , 0, 60 , 60 , 255 , 255 , 255 , 255 
i60YDU23,23*,c3,63, 15,15,3,3,0,0 
170ODU23, 2^5,233,255, 232, 232, 240,240,1^2, 1*2 
180VDU23, 236 ,E ,0, 3,3,3, 3,63,63 
190WDU23, 237, 192, 1*2,243,240, 240,240,255,255 
200wDU23,23B,c3, 63. 60, 60, 0,0,3,3 
2 10Y DU23 , 23*7 , 255, 253 ,207 , 207, L92 , 1 92 , 240 , 240 
220VDU23, 242, 255, 255,255, 255, 15,15,63,63 
230VDU23 , 243 , 252 ,252, 252 , 252 , 1 92 , 1 92 , 24 , 240 
240VDU23, 244 , 1 , 1 ,3,3,7, 15,63,255 
230VDU23,245, 128, 1 28, 1<?2. 192,224,240,252,255 
260VDU23 , 246 , 255 , 63 , IS, 7 , 3 , 3 , 1 , 1 
270VDU23,247,253,252,240,224, 192, 192,128, 128 
7R0VOI 173 , 74R , 1 , 3, 1 * , 1 7, , A3 , A3 , ?rVS , ??m 
290VDU23, 24?, 0,0, 192,192,240,240,252,252 
300CH fi J N ■' BK AC K J A^K2 " 

blackjack program 2. 

1 0MCDE 1 ; DINfi* (20) : GCQL8 , 3i HOVE8,0; DRAU» , 102B*DRAW1 2 
16 , I &2B a DRAW1276, Oi DRA«f, Bl 6COL0 , 1 1 MOVE 10. IBl 01 DRAM126 
6 1 i010rDRAW126^,9:4iDRWie,9l4:DRAUi0,i0l3 

2BPP0CD ( ■ Bl tck jack " ,4M ,992 ,31 i PRDCD < " Bl ack jack " ,46 
0,90B 1 3):PRO:D("BlackJ*eN",472,9e4 t l):PRO:DfB*t-" , ,eS2 
, < ?92,Z) sPROCDt" Bet-", 036, ?8a,0>tPROCD( "SBNt-", 840, 904,2 
) iPROCD<" " ,?4E, 988,3 > 

3BM0*aCHR«84CHR*B+CHR«t OiQI *-CHR*22S+Cr*W229+m*+CH 
R*23IH-CHn*Z31 5 CL*«CHn»Z36i-ChR*337«-nO*i-CHR»23D-rCHR*23Tl 
SP*-CHP*24a+CHft*249+nCW+CHR*24?+CHRi243:l**»ChK*232+CH 



Kf^JJ+nU*+UHHi:iJ4+L>fH*£ 1 K: 

40CR1 K« IBB): CRZX=l00; CCL0UR2; PHI NTTAB 1 1 , I * "rE, . " S t CD 
L3UR3tPRlHT' ' IBB. 00' : C0LEUR7 i P^INTTABfl , 2) "YOU. "(iCOLO 
U^asFRlNT" " JBB. 0B" 

50STK-B J PROCBTi VDIJ2S , 1 , 3« , 33, 4i CLSt VDU28 , 2,30, 37, 28 
e i X-&2B20 1 ? 

iBGCOLB , 1 ■ MO>/eiB,iai DFAH^B , 1 TCs DTtAHl 2IS3 , I £Qp DPflHl 22 

0, 3Bi DRAW60, 30: 15COLB , 3: nCvE44D,9l6i DMW44S , 1006: M0VE83 
2,916t DRAM832, 1 005: PROCD t" Yqur Handt " ,64 ,892 , 2> i hfl=B: U 
diV>fltlWllt *-2i V^-0;PPOCrEALi V-O+l i A=AO tPftOCD c "rty Han 

d:",64,31B,2» 

7BPRDCSai96 l 160,n 

eBVDU4tCLStCDL0UR3tPRINT " 3 lea«e InpLt Your stjiiei 
"l* INPUT" '^STiiJF STX>-CR111 THEN COLOUR 1 tCLSi SOUNDS, 3, 
IB, I0i PRIMT " St«k» larger thai cradit try again' tTIME 
-at REREATUNT ILTIIO350I GCTO80 

90IF STX<-0 THEN COLOLRl iCLSl EOUHD3,3,10, 10; PRINT*" 
Dh can* an chicken !" i TirE-Bi RiPEATUNTILTl ME >2BB:6DTD8 


1 BBPROCBT I CR ! X"Cft J X-STS I PftOCSC I PflOCDEAL f V«V+ ! I A-A*J t 
P^OCSQ 1320 , 160 , 1 > i VDU4i CLSe G0TD32B 
1 10DEFPRQCDEAL 

120J-IKTH |RND(1J*I3J l*liOJ-J 
1301F J-i Hf-"fl H iGDTOlE0 
140IF J-ll W*-"J' , jJ-J-l!Gt>T018B 
1S0IF ,t"f? Wt""0 ,, i,l-HT--iRflTninB 
S60IF J=1J Wf-"K"iJ-J-3iQaTDlBB 
170WS*STR*(Ji 
ie0K-TNT<RNDM )#4>+l 
lf0IF K-l R*-"8" 
2BBIF K-2 R#- rt H" 
210IF K-3 R*-^" 
22BIF K-4 R*» 1, C" 

230L— ltREPeAT:L-L*iiIF Wf+R*^ f < L } THENIM 
24BUNTIL L-U 
ZSBU U* U ft* ( U J ■•(# tR* 
260 IF X-l Wy.-i60 ELSE VYI-S44 
270PROCCARD< !V*22i)+'76,YY1tl! 

StaiF Irif-'A" TICN ON X GOTO IBa.^O ELEE ENDPAOC 
290VDU4rCL St COLOURS: INPUT » ^incunt Far flc»",Bi]F SO 
1 AND GOll COLDU^l:CLS:EOUrtD3,3,I0,10:PriNT " Either 
1 fir 1 ■ I "tTlHF»B*RFPRAnjliTTl.TT>*F>?fflB,nnTn?9R Fl RF ,1M5t 
CSiVDUSsENDPROC 

300 IF (ftA+UU=2l THEN J- 11 ELSE J-l 
318Er4DPRQC 

(centtiued on next page} 



YOUfl CDM^LFTER, MARCH 1985 127 



SOFTWARE f-ik. 



(centhued f r om previous page) 



52BIF fl>21 THEN 40C 
33B1FV-5 THEH 3781 

J4BV0U4 1 CLSi COLOUR? i PRINT ' ■ Cr.««iir = - . A*-BET+< VrtJUS 
J3BIM A*-Cin*l3 THEN '613 ELSE IP A*=" h THEN 37B EXS 
E IF fi*-"B" PRDCBLW ELSE 34B 

36GPRQCD=AL; H=-A*J I V-VM (G07D32B 
i/KVDU4j;3,S I COLOURS J PRINT'* Hf TURH-JVDU3 

5TOX". :P^OtDeAUi(W-ftft+J;V-V+ltIF AfrC 17 AND V<5 THE* 

*BHVl>lJ4,^B,2,ja,S7,30;CLS:(l>t-IO:t;aLOlja2:PR:NT rt 1 Sea 
r*d. .. ■ iflAiC0LnUR3:PR[NT" Vou Be orwd . " f A I flX=S. 2B2B<J 

11HIF AA>21 CtJl.OJ«2irSINTTflB(l3,1flJ ' 1 3ult"!WI=l 
42BIF A>?1 CdLOLR3jPR:NTTflBU3,l>"VniJ Birat " t WI -2 
15B1F V2C3 AND V<5 AND Afl<2l AND A<21 ThEN 443 ELSE 

44B1K A>AA C0L0uR3iPRIftlTrflB<lS 1 Li' i Vc.u Nin". Wi = l :GO - Q 
SIB ELSE CDL0UR2! PRINTTABt 13,0: "I Win" : Wl=2:QaTQ51B 

45B1F AA=21 "AND 'J-2 CDLOJR2: PRIMTTfiRM«5i ,a» ■ bi ackjaek 
,1 Uin";CR?7=CR2X+ST^sWI-2:G0TQ 5118 

*6BIF fti2l AND V2-2 DOC O JR3t PR1 NTT*B (13 , t i ' Bl.ick j*ck 
■ Vou /Hr ri jCRlX=rRi^*ST%;WI-l:SOTp 51lf 

4fBlF WK22 AND V-3. AMD Afi>B C0L3UFiZ:PRIMTTAB<:i5, BJ- 
5 Card Trick. I Win 11 iWI»2rS0T0 SIB 

4BBIF A<22 AND V2-S C0LDUR3i PRINTTflBt ;5,1 i "5 Caret Tr 
Jti.vju wtrr ;*i = i: buiu sib 

49BIF ftA*2l rnL0UR2:PFINTTAB<)5,*} "Pontoon- 1 Win* t HI 

=2:Rnro;io 

seeiF ft-21 zaiixjnair^iwTTflBfia, i* -Pwitoo-t.You Hii'tw 
t-1 

3IBIF WI-1 THEN S0UND1 ,4 ,H0,3fll CR1X-CR17-* (ST£*2) I CP2 
X=CR2X-ST% Fl SF nRTTC-CRSW-MrrxiFDRi-iBTGiMTcr- -* : r.nuMi>:, 
3,1,2:NEXT 

52BPR0CSC 

53BIF CRi*=» CR CR24-B VDU2B . 1 , 91, ,3« r <, Ci-S = GOTO* 1 E 
_SE 5T0 

54BIF CRJ%=* THEM PSOCDCVou Lose Tjrfcuy! " ,332,736,2 
) ELBE PROCDC'OK Vou Hin TM* Time Su :h*r ! ' , 16B, 73e ,2> 

-SBPKm,iit-hor- Another Rounrl Of Black JACk," , lir,6(IB,t 
liPROCD^Preas The Spice Bar ,"%20B b 5t *», J) 

56BREPEATI Bf -GET*E UWTILfl*-* ■ rVDU28,B,31 ,39,«iGOT04B 

r7nvi>uZQ,l , :7,30,l6sGL5jKKUi.Ot"»-Tws5 Space Par Aooth 
er Harid, '', 144,512^1 5 REPEAT: B*=^T*:UMTILB*=" "iWl)ll4:G 
DTC50 

SSSBCFPRaOCARBOtXf vs) = nnocse < xk , rx , 3 > ion k soto 5vtfl T 
6Ba,fcHa,S2ffl 



3"BDCDLB , U : U.f/. W: nuvtx>. T yX+ 192! VDU227! «OVEX^+lft2 , VX^ 
64: VDUZZ7I CES-SP*: PROCMi ENDPRCC 

6BB0CPLB , 1 : CTK= 1 : HOVE XX , Y?.* 192: yDU2'A I HOV£X*+l *2 , Vi+ 

i4 s vDurEii ce*-ic * i pftochi endpr or, 

1 1 BGCOLB , . : C3?t" i : HOWE X ^ , Vi+ 192 ; VDU22S i ttaVEX7[+ 1 *2 , V^nt 
<b4: vDU?25i CE*^M*: PROCIi ENDPROC 

A7Bfimi B,BrC05t«OiMOVEX^,V%*lf2iVDU224iMnvrK«+l6E,VK^ 
i4: VDU724: HF* UL*: PROC^s ENOPRDC 

*^BDEFPROCM[MO0E'X%+n«,V>:-96i J1«STR*(O^J l IF LEPUJ4)- 
1 OR OJ>iH VDU? 

A4B1F Ql>.l AND QJ 11 THEN PRIN1;J* ELSE PFtHfTfU* 

65BrtOVEXX,Y}>224: IF 3JJ1 AND DJ< 1 '. THEN PRlMTfCf ELS 
E PRIN'iH* 

A4BIF DJ>1 AMD 0J< 1 1 THEN PR3CC< Jt, X5C+32, YX+1 AB^COK) 
ELSE IF 3J01 PROCDCWt,X7.*32,lfX+ltO,LaXJ 

&7BIF DJ-J hOWiEXX+AA^Y'ji+lAOj^RINTCE* 

60tteNftr4xx 

frBDEFP^acsa: *%. yx^col > t bcols , col l hqje xx , rr,, ia^xi+i 

92 , YX 6 PLDTB5 , XK+ 1^2 , YX+Z~6: flOyEXX , Yl+2SAi PLOT S3 ,**, Ytl 
yDU3iBCOLfl,OiM0wEKx,Ylt*3Ei^liUl'4i : nDVCXl!» 164,VK+3*iV3UZ 
44 1 I10WE X X+ 1 64 , /K+256 1 V3U 246 : NO JE XX , v?>25£ : V0IJ247 : SOUND 
B, 2,4 , '. t SOUHDB , B t B , B : ENDFRDC 

7«BDCFPROCSTjVnil?fi..l?, , ?,"«!l 1 lTCLBi :F CT»=B P«3CC(-B.a 
B" , 11924 ,'?Ba,3> :G0TO72B 

71BS'*-5Tfi*<STX> iPRDCDOT*, J 003, 90S, 5> iAL^LENKST*' *3 
2iPF0CD ! ".BB" , AL+1Bj4 ,?Q0.3> 

7 2B VDU23 , 2 , 30 , 37 , IB : ENDPREJC 

73BD€FF^OCBCiVDJ2E r fl,31,3 E P,aiCa.0UR3sIF CR2K-B C.K7X 
-fltCOLOURI 

/«ffl|N( ifBIO, U ;CR2Xj " "lCtHJQUR3: l r DRl«<---ll LHli=B 
i COLOUR 1 

73BPRINTTPB(i*,,2} ;CR1I| ■ "': COLDUR^i V3UZB,Z, 30 , 37 ,2B: 
rHDFTtOC 

76BDEFPRQCBUV 

77BVW4jCOLOUR2!CLSiPRIHT°- Hqh Much da you «*nt to 
P»y 7-'jt 1WPUT- —SUiiir DJX>CR:* THEN COLXUft i 1 CLll SDUKi 
D3^3, IB^BsPRINT " Tod muzh trr ajmin? , :TINE»BsRS > EflT(J 
N" I LT I MS >2BB: CLS: SOTTJ77B 

7BBSTTi=ST>:+BUX.: CB 17=CR1 Jt-FLHii PfiOCSTi PRCCGCi TLEiCNDrT! 
OC 

79a»EFPftOCD < &t , £ , L , CO ) 

BBaOCOLfl, CO; LOCAL N: AX-4A l XX«Bi fX-Afli tl=4,(««r .F lenia 
*1-1 K=K+:6 

BiaFDRN«l TO LEW (AH sB*=HID* ' At, N , 1 1 J ^D-AEC tB* > ; CfiLL 
i ItFFFl > i VDU23,24fl , D?l ,D^I , Dr?2 , D?2 , D73 , D73 , C4 . 0^4 . 23 , 
iJ-L ,J , *5,Q' T S,0?i,O"'A,[> r7 7,D ,, 7,D?B,Dl'B:yDU3:MD^PK- (N*32) , 
LiVDU24fl:nQV£K-HN*32) ,L"32: VDU24 1 j Nf K T N: VDL4: ENCPRPC 



Utilities 

TS Whattvti. 
County Durham, 






Tui-SlS ft LCAD3S prtigrHm For three nuchiiic- 

cede rouiines whitK are is follow*; 

■ A casseiu: mmcr swiich; this jwhcic* ihe 

casque nuHOT on so that lLspis tan be re- 

WOUIld Of fflSl forffardtd whilr yd]t »tt using 

the kcyboaid lo program or a program is 

running- 

Til- relevant Dau aatcmcnls arc in lines 

4C-50. After niTining type: 

SYS 673 
Ft Key will now switch ihc tasscuc mcnor on 
Fl Key will swilc.i il ofT, 
To kill this «)urine pfess Run Siop/Rcstttfe, 
| Rrndom eriiracier co'our: [his brightens 
th: fcie:n up wiien you arc typing by 
c ban ping ihc OOtow of etch tharaticr as. vou 
type The cursor also Hashes different olourj. 
It docs no! print a diaracter the sime cdour as 
the screen so all thancters should be vi\ihlr 
wbichcvtr screen colour you use. It also adds 
coinir to the liftings. 

The relevant Dtfa «totfm#nta otj: ia li:\t,i 
70-SO After running tvpt: 
SYS 673 

To kill this routines pres Run St op/ Res tore. 
^ Clear screen: iHs 'ou:inc enables /ou to 
clear areas nf the screen and kav* the ics.1 
intact 

SYS ft73 clear, ihc lop half of the screen. As 
it ls ii clears the top eleven lines. To change 



the number cf lines Ptilcc f74. X where X "\% a 
number between 0-22. This clears X.+ 1 lints, 

SYS 678 dears the botuim half of the 
screen, The routine wili clear the boftom 
twelve lines, To change this Poke 6B^ to a 
number bitween 0-21 Tlii^ murine can abo 
be iised io clsar the middle p the scresn by 
poking u number hetwetn U-2S to location &!*} 
wnJeb is greater ihan mat in loeaiion 685. 

SYS 691 clean the Icfi elc/en co.unns oF 
the screen Tt> change t¥ ihibiIim tit'celumni; 



Poke 691 with n number bcrwixn 1-21. 

SYS ?04 clears the right eleven eclunns 
To Clause Poke 124 » r irh a nu;nber tetweer 
0-20. 

To use the routine? type in the oadcr and 
ihc rvlpvnm dtta attttcm^nti ftr tic rouiuit 
you W». The Fit St two will net run together, 
The third can be used with the ather two ifii 
is loaded into i difTcieni aria of memory as 
Long as the call addressee lo I he rcutiaes are 
changed to :he rtcw memory area. 



VIC UtHit!0$ 




ie rx>73 




2B REHDR IFR-i^SlHEHEm 




3& POKEO-B 0-0+1 QOTOW 




3S HimBtCnU[VTE MOIUR 5UITCH 




1U iJMlMliW.l^H, 174,141 ,30. 3, 169,2, 141. 31,3, 38,36/ LS5,lS7,SBl J 39.24a, 7 Ze: 


-47,240 


,2i,76 




41 WTB1?1,234, 173, 17, |45,9r64, , + ! . 17. 14?, 1?3 , 26 14*, 41, ii, 1*11 . i? , 143,76. 


19:, 234 


,159,234 




42 DRTR141 ,28, 14-, L63>,e2, 14] ,17 145, 76, l?l,234 




M Bflr«9?9 




6.9 REFHHHHtRH^DOl CHRWGTEK CULQLIR 




70 Dnr»l£B,16», 174, 141 20, 3,169, J, 141, 21, 3, M, 56. 169.8,141, 27,143,17^,24, 


143,77, 


2fl 143 




71 DHTflU,?, 153,234,173, t=, 144, 74,74,74, 14,4] i fi 13/ , ZS*, 283, 14, 56,42, 41 ,^ 


,291,7, 


ZWr3 




72 Dflrme.41,7,24, 139,254, 165* 254, 141,134-2 76 191,234 




96 DR1H9J9 




S^ PEf1*«*L'LtFIP SCREEN 




9* 




er 




99 REn*W*T0P 




9? HH"rt]^,l«. 7 r? 1^? ■ W- 




59 g?Fn**«S(ll TflH 




ie« Dfimi62.2J!.j2,l41,254iae2.224iie,iW-24e,76 J t2?i?2f 




iff? REM*^*L£FT 




Htf DfiTRE62 22 l6e,l|f,3if-H3,J34,2e2xl&^4e-?6,12?,2l9 




1 1? «EN»"»R]*T 




12* IWm)*2.22. 16e,2l>32,1^6>234, 32, 179, 234, 169, 3j!, US- 2B9 169 < 1, 145,243, 


136 192 


I2J IWTM:a,i0e 23 T ,2?i2,l€,232, /6, 1*9,229 




J 2? BATHS' 





136 YOJR ^OMPLTEfl, MARCH 1965 




Tape Index 

Terence Brow, 
Pontetaid, 
Nfiwcastia upon Tyne* 



T^IS KtOTrMM CTzr«& a file of iht cassettes 
contents ant should normal ly bt UVCd HI iht 
brgmmnn of Stdc I- li [Ujv be used for eithei 
rh* li^K nr 4fiK Rncctrun, Alter entering the 
procram, Run, You will then be ask^d to eatet 
the Tape Title aittr vhich ne mcr.u is giver 
providing options n>; 

1. Print Contents of cats memory. 

2. LPrlnl Contents of data memory. 



SOFTWARE fit 



3, fcnter new data trio memofy. 

4, Change ex sting data memory. 

5, Save program and data memory. 

6, Stop program. 

A:ter the program has butm OrVOd any tuture 
Load will result in ii au:0 starting at option I. 

When enter ine. Data there is no mrcti lo enter 
the data in hi-iIt hk flit* prn^rflim rfnrsins i Sort 
subroutine — lin« ^00 to 9W — wlikrh will 
sort in:o order of, first, side and rien tape 
connect. 

For those who (in not yet know how to enter 
line l\, *>n?*r ihi* lirv at line and lfter that 
Enter ss a dir:ct command 

POKE 23756,0 



^—^—"■^^^^^■■bbbbbbbb^™ 

Line I will now b- changed to line 0. 

The data memory has been cimtn stoned as 
13 because this fills one screen without bang 
aiked "scroll?" and this is usually sullkient for 
most compiler tapes However;, if additional 
d-tta mcJiuuy is icq inied then al:cr the value if 
'Y"Lnline]0. 

If vou Break iht procram foranT rtasEio d3 
nin ype Run as ihi? will dear all variables/ 
strings. Rettan by entering 

GOTO 40 
However, C-flCt tht pfOgfsrr has hsx-n us^d il 
iuuv be :eu;ed on another tape by breiting the 
proexarr — option 6 — then press Run to -Icir 
the memory for new Jala. 



O^JEH ** TAPE :nC"H> 
® TEPPf BOOJN 

iO i_fc 4 = 1* W1TI *l^J. til- Cf< 

u,*) • orMP*:y,10' D»* ctftli C 

IM «*(3 . FOB T1-1 TO * l£T a (ft I 
■n- HEX - r 

£B IWJT *' 0,e,-'T-tPE TITLE 

_INE « 

2* IF LEii :*)3fi THEN GO TO St 

30 LET C*tl>a 1000" LET F*U> 
.-:ts rNOE>: 

13 COftC'EP ': PAPER 7 UK 0; B 
BI3HT O; CLS 

50 PRrtJT p.- 0,0;" 
-:ht i ,n, - rnnrrFHT*. tn^f* »;fl 
T 8,e; " 

50 PB£NT "OPTIONS flUPlLPBL^" 
L . PRINT CONTEr,T3 ' 

s LPRirr c£n-emt3 

ENTER NEU t>AT£ t j BM4N 

:~ ' ^'^ 5 5P.UE" 6 

STOP- 
TO IN^UT RT e,0 "BNTfP OPT ID m 
N-jIIDEP , LH^fi I*: IP tt<"l" O 

R 7. J; "6" THEN GO - 70 

ea go tc usl Tf *ioo 

IOH hM^DFP - P^PEP ~ 1HK O: B 
tlGMT 1. CJ_5 

113 PRINT P^PEP ;. j NK t.^T a. I 
iB2>UEN l*!ya .11 SJ SUB 70 
2 iHF-iT (it j.;.-*PRE33 EKTEB *i 
_;hir .*. »g tc -*r 

£00 LPRIHT I?<\£PSE 1 . HT J INT 
( 53 -LEH HI /3 1 ; T * ■ LPR TNT 
SlO tPBIMT BT ^.C:"SrOE- RT ^ o 



::.-- ~- i. .-. PftocRfln _ ' _ Lr 
2£0 LPP.JMT1 'OP n=l TO u 
23B ir ciuim tmch lp 

riht thb 3;cli'in , l ) ;trb 7; c i i » 
in) .2 TO I ;TAB £0.PttVfn > 
ZiC ME«T n 03 TO iO 

:oo cus PKr-fT -- : -: ■•cr-rrc«r" 

■3 HEJ tSTR" F3P n»i tfl | 

31C ir ci'i, fn'ti MSH 63 

SUB 90fi 00 it'E JiC JMPUT BT ^ 

S "CO VOU UriH TO E'lTEP «N0TrtffP 

LIt« IS IF a* ' 1 ■ = "• ■ '"'P " 
)>: =' »- Th£1>j LiD TO eifp 

:.ZC 'JE'T r. CPITJT TT 6 ,16; "MEMO 
r t-,iiL' PflUEC £00. GO T 900 

Lee CIS. . PRIn T AT 0,1; Ci-RhSIi-J 
DFTfl" <in j L ie ">fi^ 

11C INPUT AT 0,0 'ENTER "SIDE 
and COUNT OF TTEMTO BE Ci-flHGEr 
_INE dt, ■' LINK et 

:; fcp n=i -to . 
-:; if emtttn i-itii TiEr- CLS 

PP2MT RT D, 9 --MftHeiWS DSTfl- 
co soe> sac re;';- «: i.: - o 
i.ii,^- s i* tat-v <ri) ,a T3 ■ at e 

. p$ ^ tn • fO 5(J© -SiO 2'NPjT 
AT 0.0. CO 'OU "JI3H TO C1AHCE Pi. 
OTHER 7 ". LII« it IF 31 I ] I «'T. 

OR J«iX:e!3" THEN 00 TO ?0O 

i4.il N*XT n GO ~o +oa 

EJC GL3 POINT AT 10,5 "PEUIHC 

-- -■= ro ueeocr," ia^F "rrs Twr 
EX" LIMB Dfl -:i_; PRIMT 4T 6 < 

t h:: ^p:3Pac nij been jsje: - 

T iO # lS;-TC -"". ';AT U-f REtJ 



.'E 3 I ; 



JTJ 



INC- T3PE AMD PLRV 

-•i7r- so to i r 

:;; STOP 

-Ci? PR3HT AT Z Z- IIOE" RT I s 

■ ' RT I _. SR0€P«i t : t L£ 
Tl-t PRINT POS rial TC - 

T2P :r cj'wt. . . ;■■ ■■ then t- 

INT THb £ ; {ft* t n 3 ,1J TRB 7 , : I (» ' 

n i . 3 TO i ;TBE ae,P> '.'J ini i 
730 N*>'T 1 : PE T| JPN 
KM PDTNT BT J..S "5 IDE " . AT 

■ *~ I 6;"PP0GRq f l 



'COUNT 

"ffTJR-: 

e;c :■;■'. - 
_:*.r * 

3 SO INPUT A~ 
LZ11C «J 



C P- -EHTEP 90€ 
= =Z'-IT ST i.." i 
; B: EH-E= COUNi" 
rp3t;- i' f ;->■ i 4 

84.3 INPUT AT 00. "ENTER PROiRfi 
M- Lit* f* «(DI FPIHT AT £ 

.l'-H'OlH! I ■ L?T L»iaill) ::><!.) 

BSO INPUT fi T 0: "Ape OE' , niL& C 

pRfieCT ^ "; LIN3 «« IF *$(!)■■( 

■?p 3* li-'M- THEN SO TO OSO 

,?toO PR2NT f|T 4.. IT." ",RT 6,17 " 

':AT *,17 RET'JP 

H 

seo "0= >*i -; --: let , -o fc 

? I -< vl TO u 



■ :: : 



- i 



ET M 

^-.- r -i- 
950 -|E T > 



.t~ 



■ « - THEM L 

■ • LET y i 



T.F 1.0 THE?J JO TO i 
■JO TO 100 



O R 


EM *"*• PRtNT 


^~ 


— >■ 


L, V I* X W T * * 








3. HttM **« HALLDOR 


ROSGEDO ■**< 








2 REM >*"*• 


s^s/att 




I* 3*1 








3 RKM 
















to 


FORM- 3 Q O O OTO^fl S 8S 












ao 


RKA,0 DTAt 
















TO 


DTA.— ■VA.L, C ,T **" 


*- D T A * 












UQ 


H« — ERi-DTA 
















& o 


FQKSIM , D'I'A 
















e o 


niext 
















TO 


IFEPOl OaasrHEMPRINT 


" DAT A 


ERHOM" 1 


KTOF> 


ao 


E>Ft INT"DATA 


t?t*. 


ti 












«o 


PRINT; PRINT 


"PRESS 


A 


KEY TO 


CSAVE" 




q 5 


OETA* I CB.AVH 


■»p_ 


L* P " 


, A^8000 . H. 


3eaae 




LOO 


DATAAO . ?-P r . 


A9 . 


nc . 


t\ \-. . 


O J. . A 9 . 


O H , 


as 




iiO 


DATAQ2 . AS. 


o c . 


CO . 


UA , 


=>C , 07 . 


A A » 


AO 




3. E O 


E>ATAOr. OS. 


o c- , 


po . 


e#, 


■ ^ "5 • =3^l . 


a s . 


(3 O 




13C 


DATAAZ, flF, 


A** 


oc » 


as p 


o3,ce. 


30 * 


OS 




3_ii.O 


DATAE6. OZ, 


ii J . 


o a. . 


ere . 


oo , =>e . 


09 . 


me> 




190 


DATA03 - AO. 


03. 


C^p 


03. 


"> C , EC , 


so. 


Bk 15 




i «0 


DATAOA , A.5 * 


03, 


cs » 


oc . 


H-C . J- -± . 


cb . 


=iO 




1 T-O 


DATAOZ , 3 C . 


<?sr . 


*t# • 


03 . 


A5 . OS T 


C:^ , 


=>3 




1BO 


DATA90. P~a - 


31. 


Ol . 


sc . 


Q ^ . A B . 


O/J . 


cs 




t «irt 


fsATAnrr. *^rt. 


•^^ - 


aA. 


41. 


Oi . l>o , 


C*» 







Print to LPrint 



Haildor Rossebo, 
Norway. 



r j~ 






This HACHWB^dOB iregram ;cp"aces ill 

Prints ii l B»iu pin^iain with r.Piiuia, .ti.il 
tice versa. It wa* wrin^n t>n in Oric-I 4SK, 
hut it will alsj work on the 16K Aimos The 
mftchirc-OKk is "ully rtk>ta table. 

To get the machine-code gcing call HflOD. 
II" yuu ibea i»t vjui Dasic program ;oull »c 
thai all tit prints hsve betn chf.n^ed to 
l.Print. Another call w 11 change rhem boot, 

The swtdi ti located in (#)C, and other 
v j lues then H BA b*re will mate he prfigram 
eonvcr Pritm 10 LFrir.ts. 



Catalogue 



4 C Otiver, 
Doo waits, 
Corn wait. 



2Q03SC? 



This program allows you to make a 
catalogue cf piogiams stored on tissiiu-. Tl.e 
prosratn, wrltter. in poiiiicn-lndependcni 
code, was orijmslly designed for R^m, hut 
will rf^udr iinywlwre- in Ram. 

Oi eKccutio^ you art: isked if you rcqiirc a 
printout. Typing any other key than Y will 
lust put * pnrtout m the $crcm. To hold the 
present information on the sceen, iuM lum 
flfTrhe rap; derk. 

Ti ci it from tie program you must ores* 
the restt button. 



i> mi >*.;l ],«' - 


r ~i 


1 r**i 












246BB 




7D 


■"D 


m 


*T> 


7n 


7W 


■ft!) 


t;d 




400 


JD he* ita 


■ «fT. r-r ... < mntn r :t-.. i 










SC4ABB 




3D 


3n 


?D 


'L, 


'U- 


JJJ 


in 


.<:., 


- 


4 IMS 


tD *W»fT " 


BTTB 


»|finr midk *< ' 


■ ll*U' ITMtF 






24*^6 


t 


Jl> 


■D 


l*l> 


m 


M> 


HO 


27 


a* 


■ 


t72 


» »«HT ' 


E>i-|;n 


r rNir,,, 


■ :r:,i I .-.- 


, HW FIKHH 




247B4 


E 


■-" 


w 


/n 


r-H 


W 


RTT 


i": 


Fin 


* 


8S4 












































•a r*t«T » i ■ 1 - 




















24712 


I 


H 


?c 


26 


46 


(E 


Bb 


Bl 


ST 


■ 


4TS 


» Tt<«6i]|*uf *»«f-ft 
















2472B 


: 


Mt 


H5 


Ft) 


f7 


?T 


m 


e=t 


7-i 


■ 


T77 


M nr 6-i 


in vt'M'rfun mm- 


J 












24T2B 


t 


F7 


za 


E4 


FD 


« 


BC 


AD 


9F 


w 


1)74 


100 TT-T-fi 


-Vfc |FT*7L >h 


" • . 


f 














24T36 


■ 


«2 


BS 


?■) 


7F 


B2 


BZ 


7F 


B2 


« 


334 


■lb <«iph-i 

IM S#UT 


Mptt 




















24744 


I 


•3 


SE 


*6 


4a 


EF 


BB 


TE 


» 


■ 


-■! 


T* 




















2!4'32 


I 


•P 


f.B 


P4 


. i' 


SF 


m 


Hh 


2b 


- 


»a» 


190 ** »*.llln 


-■! 


I"i» 


FR1«T n 




i - - EHim 


LI4 MAI 


r*"V 


1 


IB 


i (, 


ea 


7C 


17 


C6, 


at 


C* 


* 


7*B 


■"tlKTO t: 
!*0 H ■" 






















74 'AH 


I 


U> 


B7 


F2 


4E 


E7 


HD 


HZ 


Zfl 


■ 


4B1 






















a*T?i 


1 


CI 


04. 


93 


03 


*C 


D7 


<E2 


91 


M 


ID9 


j^ai-A T 


17 


at 


27 


IB 


nc 


Bf 


Afi 


Bl 


- 


3*9 


9*^04 


1 


20 


El 


FII 


a#, 


FA 


en 


RJ 


a? 


- 


793 


Z*3B4 t 


2 T 


in 


Bl 


BB 


Bt 


20 


F7 


eo 


^ 


6«4 


2**92 


1 


01 


*F 


F6 


P2 


E2 


CD 


2C 


■?:, 


1- 


»4 


i«3»Z r 


BO 


« 


H3 


4S 


» 


H 


32 


49 


■ 


317 


2*e«fl 


1 


Tfl 


Hit 


m 


IE 


F^ 


FD 


B4 


L£ 


» 


317 


Z46AB t 


4t 


n» 


T: 


tKI 


M 


34, 


^r 


bfe 


■ 


3VI 


■' »H¥I!- 


I 


vt 


PU 


to 


ED 


2D 


B6 


«e 


B7 


■ 


V6S 


2464S I 


20 


M 


BD 


an 


PI 


1IC 


DO 


B& 


w 


■'.!•- 


24.S16 


1 


02 


01 


»F 


F6 


»?. 


B3 


ro 


13 


— 


493 


3*416 F 


2* 


FS 


ei 


3" 


37 


BE 


RE 


Bl 


- 


iJH 


24S74 


- 


8» 


:a 


ce- 


?B 


IE 


B9 


a) 


9B 


= 


7Bl 


. l **.,-r4 e 


M 


r,r^ 


B? 


flj 


1? 


ee 


EE 


2fl 


-. 


337 


24832 


t 


IE 


B9 


hl> 


*?7 


66 


en 


RTl 


93 


m 


394 


24632 : 


■It 


HE 


B» 


et 


bf 


•3 


H3 


17 


- 


31 n 


. -Vl-iV 


1 


16 


FF 


714 


3B 


"V 


HI 


BA 


25 


— 


736 


H4*B E 


4W 


El 


3D 


■hc 


«I4 


■c 


33 


2fl 


- 


643 


24940 


1 


03 


Ed 


flA 


flc 


"ft 


B2 


Bl 


7h 


k 


39*. 


24640 1 


M 


AS 


ab 


46 


»S 


4C 


4B 


4t 


m 


■»:,J 


.■4ti:.f 


1 


f'l 


J 1 ? 


66 


?0 


C6 


B3 


17 


F r 


= 


?46 


3*A*4A ! 


41, 


AG 


45 


20 


20 


2E 


2fl 


42 


— 


4»3 


Mil/. .I 


: 


7n 


sn 


£6. 


l-ft 


it 


Hh. 


104 


HH 


a. 


7H5 


246S4 r 


4C 


-IP 


(=,- 


?a 


70 


?l? 


45 


57 


- 


431 


24072 


I 


F.r 


oa 


(.11 


1,6 


M 


fl7 


FW 


8" 


= 


593 


-'46/2 i 


S2 


53 


BP 


70 


Sf 


31 


Ti 


7Q 


~ 


433 


24S00 


1 


W. 


BB 


Si 


F? 


3? 


■ 


330 







YOUR COM PUTER , MARCH 1 <35 129 



INDEX 

Simon Rollins completes trie 
updated version of the YC index. 
The first digit after the reference 
refers to the volume number, the 
second to issue number and the 
third to the page. 



vie: a 

filtunen, 2, Hi, *l 

Cwcltr. 1. 5. S3 

Coil. 4. 3, 101 

Cduur and iwiid, If I- 38 

Q»iiniittmiLo<'3 |K-rt. i t 1,44 

Daw. I, 7- I in 

ElCWUhn, J, 11, !J7 

Gamrji stt.- GAM tS 

Hi.;K fetttutJM Graph «. J. 4, 57 

Hi7h Frv>knii>» Giaphcs, ., 3, 29 

Joptiri owrnl. I, t, 3» 

Mllti-<akn.red .-ranhif-v. 3, 1, Si 

Mtlli'tffvC-l, 3. 7, II 

Masii-.?. ?,ii 
Po.¥|*iiflic l*TOjie, 3, J. Ml 

t"n...t..i)[- 

ui Elfin, i, 'f, iil 

Alien Arcade, 2, 4, 77 
Alien FtaJwi, V r 10, 1*6 

AppV f*"^. -1. 10. 175 
AHItt Gljdulor 3, *, 117 
Blue* 4iraph>ci, 2, 5, 7* 
BotttKrr, 2, 12,99 
fcr-jfchipO.n., J, -t.Ti 
CFSSI. 4,1, 101 
Chugbjl Goals, 1, 2, 123 

1 hi !■:>■ or idtaetTi 2. '. 9ti 

Chancier IdiTor. J. 7, 175 
Clttk J, 7, IK 
IV mi.il I-iier, J, 2. 137 
DidkiM fr, I* 1 1, 101 

Dodferu, :, U 212 
UouWc Hf^iK, 3, 10, 211? 
Earth h^-KCj-, 3, fl, 79 
Fifhler RaiJ, 2, 5, I J 
Flu-Car.-her, 4, ?, I»l 
F«< baler, i, 3, IH 
Fair KMiiiac*. 1, 2- 12a 
Grid Grubber, 3, S. 159 
lirmh SctWfl, », Jl, 105 
Grmvird-20, 1, 12, I8» 
(iLCss Wbo - Man, i M57 

tfUr^MJ'l! thifv.i- !*, J, 70 
Hijli ftfjuEulior, 2,5, 75 

[ildrMl, 2. 10. »S 

Ke.Ti ruiciiriii. 2, ft, 73 
Ke/ Ward Jdlirf , % S. 171 

Lilt. 3,6, 1KI 
I. If: Kuntincy, 2, </, H\ 
l.iphr Cycles, 4, 6, 180 
Mconlsrui, 1, 5, 171 
Ni-chT Tnir, 1,11, JOT 
On ihe Grid, H, J, 138 
IV«ki ii Hi IoV«. 2, ft, 67 
Cbm Km. 2, 1, H 

l>lit)jl(,4, ., IW 

Foly - I'm nsuiie. !, II, 91 
i$adt u*p>*, 3, 1, 115 

Hnielimk, i, '/, 157 
Ragtime RAM. 2, 7. 6 J 
Skit 'Weil in., 1. lit, 201 
Swrtd Opium, >, 4, 137 

S.»iitil* l'ririkilijr r ). It 139 
SrtHliK ill ^i:i:r«. 2,8, t5 

Sprinlei, 5, 1, I!i5 
Silt. Hwi, 1,5.165 

Swo!h -I. II. IP* 

Killer, 3. ) t 123 
Th» Sim-. '■ I .;>pir,:niii;, 4. i, 

17* 

TkwD-Macfil»rirn, I 7, 125 

TiWOHlti irf "e'jj.of.i »1t 3. 77 

Tr«sttr-f oi" /^.lii J I, i, Ifrl 

Tpth II, >, *, n9 

Tuftae! Vision, J. 6, 77 

Vlt: Stkk (i(4ujfci> t in\s:LL-lrj, }.. (2, 

ll>n 

VIC Sjw»», 2, IL IH 
Kciolu'.iDD, ',. }. I \ 
S«ii'» jf* ■mi\K\ , 2, t, 24 
^Surw^i* mrrev. 2, '.», » 

SalTwtrt vm-vy. J, *, fti 

Safiur-art \umey, I, 1 ! , *7 

'1'hinei. Is do with Vimr VH . ■. fi. 

11') 



Trkk», 3, J 2, 14H 
tilililicm 

ss 

Aiib NjmbiT, 4, 4, 187 
Bwiup 4, V 177 
Ijllkiflir, I, J, 1A3 
Dbwenliltf, 1,6, U 

Dnt, ♦, 7, I0D 

K*p«n**vn. I, 1ft. 1*1 

l-.si .-nilol HiSic. 5, 11, 171 

Ltw Dtletc 4, l, 2»l 

MCMner,5, U 173 

Ktw C»*«iiuiiJ-, ■!, 12, 197/ 

I'jMllfl I'rillcl .iiKil'jvr t, \ 111 

Sirint Diim-i. ], 12, 231 

1.1(1 Hv ?fo*ramj,4. IU. 181 

Zi|* 1 ,eim1, 5j LJ$1 

Variables, 3, 4. 95 

VctlAi*, 2. liftl 

V.Htmn (lit vit„ ;, , n 7 

Timiiir'-iivS T:chs(»laty, 3, 1, 3>4 

WulMinS Forts, 4, 7, G9 

Wtw'tln f mil -ill, I. IX 71 

Your Computer Index (Vii.iiiiitti 1-9), 

A r : -■■:u 

Wr-tuili a WorJ Prntcnor, 1, 7. 7", 
/Vifl -fll ***!*, I. 1, 1') 
7\S0 Keyboard Chiitijit:. .' . 
/XW -SI Machine <^l»Je 
I'nfsranuiunj, I, :, 2n 
/..tttf-ttl Muclifictrodc 
tPragramming, I, 4, S7 
ZXtti Pecki & Pokeit, , I , '29 
/ X»M M >,.l.w.... S,.-t. A 1,3. 14 
ZXSD ROM Smich. 1 , J, 3> 
/X*l 

Aii^tnLirf Wrri w. (we Lurre.-iiors 2, t, 
I )>, 3, 4. 24 

Animitd Gaphics bet (inTrciioifc 2. 3. 
H>,2. ;. 52 

BcttJ Buic II a K — MT <™-r<-rinr* 4, A, 

Cflpbilifiaifi, * 37 
Curtis ulTac, j, fi, 147 

Cliiu OK), tj 12; M 

i".hP»|lK.) r >, I SI 

an»llK),3, 2 100 

tin*' Rwitic f$ i r toritdvinf. -1. 3. +11. 

4, 2, 107 

kiwig OfXfilioti, 1. 4, 7f> 

1-jl.rd 1 LIS. :, 111, III' 
FtM B-iir.. 3,7,1» 

Font) -Sinulitior, J, 12, M 

G«*cs«C AMI'S 

Uinc* vrnup, (IKj 2, I, (■* i*t* 

currxiiciia 1, I, 27) 

Gimtn viiliiK OK), 2, 12, 73 

Graphic, 2, 1, 48 

LiKfcMi-, 2. 9. 48 

Jjjystickh {cunstrumoa), 2, 5, 4ft 

Mmlinit OM&! i>t;e, -*. STjste ua-rm^ldfit 

i.^ in 

MjJiIni endr urtr, i. K 14 
MKliinr to* luia, 2, 9, 72 
MukJiim enk rhtt. 2, ID, tit (m» 
CfiriwiimH 1, \. m 
Mjdii nr iiwt r'n-n , 7, 1 1, 83 
Madii ik todc ciiicof (iiikj, i, 3, ^S 
Midline c™t BtKthtr, 3 6, W 

Miftiit :, 3, M 

1'inl.ill. '. II. It, 

t[» 0X0. I, ft. 171 
Mki ABAi 2,7,5 
,M*i S'utMEKl. 2, I.* 2 
A'rk ttnvj]{IK), 1, > 79 

Arll.j] d*df(c (IK). 2. i., .,, 
Answlt frait { I citt), J, li, h9 
As. wu like t (lii), 2, 7, 32 
Aiilwlmlii R.-lll {IhK), 2,9, *5 
AuloRrn (IK). 3. II. 2:7 
Kji^Jin plaid (1 K). I, I. 1» 
8jiK truh < K), 2, J| 73 

IUg|pn V1«) <IK), I. 4, 72 

Itiorwttaift (IhK), 2,4, SO 



Bnrdcr-I ne >:tw I K]i 2, 7, 9l 
K<.jdiMiit;l(,Ki. 2TS,M 
Komtt dBpoul(IK), I, 5. 79 
BomtflKjf sd, 4, 5, l&J 
Bom Idk (1iK). 3. 4, 15! 

Boo^ltJ, 4, 9. l- _, 5 

titahmi 'IK.', 2, 4, 7? 
i:iku.ai«l Htsi(lK) 2, », 7-' 
Otkiilalw 1 16K) 2, S, ft 
(>,(»[ '\tvnU. 4, !>►, I * 

CiriTrdaC 1 611)1,2, t. 69 
iJMk 01" Ciiuuii, 4, 1 1. 183 
Glut lo Clues {IHJl J.^oi 
Cod; nudiire, (JK), }, I, IM 
L"jhJ> vTi-rilge, 2, 10, »1 
:;«li ECKHlCf, (SK.J, 2, 6, 67 
CkIliihi S*rt]l, 2, 10 91 
."uniJ^i; miniv ;i6k). 1 2, 41 
rJHIpiitr, IKU', 1,70 
^miilr he Ortde, | Kl. 1 . 1 71 
^nint md Tim, (IK), ,\ 7,«5 
Oic«l seure, f IfKj, 2. 1, f.l 
■jtcwwpkI c)u]ki||«, I, I, 47 

CypV-i JlrtikcT (lli), 2, 4, ?j 
^an7.tr Man (1 tQ, 3, 7, 151 
>jtjfj]c (Spiead'lwft 4, 2, I3U 
,l w t(bWciTm(lKK ?,<*, ,59 

>aff l>cnl,{l6K),2, 2, Hi 
Dice Thrawcj, 2 = 5, IS 

>is:i,!rfiiibi::u, - i. H^ 
D/ttnl* Hf-igu ( |3t- ni^O. 2. 4, Gl 
;lr»wia S Prrt.van (1K) 4 A. 6, |(ii 
!)nn;i'(Ji1i, (IK). 2, tt. 7^ (^ce LuirertMirki 
♦, lt>, 15> 

EUToitlttii nuts (IK), 2, I, 61 
rtnKtfpnx- R«*iif (IK), 2, 3, 71 
htjiKlKmi wihcd<IK , 2, 2, 74 
Fw»ni nKrkt 'I It J, 1,3, 6S 
Em* uaJ inpMl (P«i«l), 2, 1, 2( 
Fwrtr gfljilli:s, i, «, Nl 
Fw,tw 5,l»w nfid*, 2, 4, 7J 
Klgtltf Ulunl&R), 2, i, fi 
Jiffiye htnditrvf, (IK''. 1, <j 74 
Filing Pianl 0.2'K), 2, 9. 95 
Formtda fbt Suwv.m, 2. 2. 7S 
four jc fair k lew. (!*.K). 3, 1, Jf7 

Frtc nKiBdiv. 1, 1, ft' 
tVaafilfiFsJ. 1, 12,21 

Ojdj4iIi- 5ijllih> ilfjjy, 2, fi, 61 
frlfrl rv-il ntutner, ., 3, 65 
HilfLirV i, ! 
Iks ronven, 2. ft, 76 
I1it,hrcu>luii«ii Rnph, 2, IG, *7 
Hal pursuit, 2,5.79 
tnruxfiu inJoLtmi, I, 3, 6t 
lnt«!«£cnt Ari«i« (JK), X V. 151 
Keyboard neViftc, 2, >, 72 

ker.fc Junp (i6Ki, 3, A, l"fl 
L»i,trKip;{l4K},2, 9. 89 
I,»ut,iI n.rull, ()6Ki, 2, 1,71 
Ulest m (l«Ki L3, 67 
Lcarairr]; fun, 2, 2, 71 
I mf Jiw«, I, i. 48 
LliJl remedy, 1, J, I J5 
I isi rclf Atntn, 2, 12, 1 1» 
[.rawrr raw (1GK) 2, 9, L .K 
Lunar mamien vrr (16K.). i, 4. 75 

Mschnc .-ode lips I, % 71 

Meth leaching, I, 5, 75 

Marri* Mum (iKj. 3 h. 1st 

Moizei:hjie, It I. i2S(s«ci>nec1a«ni 3, 

3.281 

Mcmxv KWiamy, 2, 1, 63 

,Mcmjc>' Man, i, 5, ]'a(IK) 

A1ilT» '. , H, Bi 

MLil«-jlc-tltiK;i, 2, 1,67 
Moor lanJcr, 2, I. -Til 
Bfarviaf fifBphif*, 1, 4. 69 
Muvh nvwiut. 2- 12, )09 
Atyi;lrry r 2, 1 ,111 
Slratity ft#(tftm, S, I, 72 
fairer 9 C-oUnfiard, |, 5, 77 
Ntw j'jiri. 2, 12, 105 
>nl >i (ir.iiEc IVrt InKl, :, i, T>: 
Nau^tir> itkI (tmi " ■ 

^umtct St|Uiiic < hK), 3, I, 127 
Cntic i unci ( 1 6 K), i, 6,70 
P<l„i4,^Tt «. , =>, 77 
rjdinili: (liiK) 3. 1, 173 
IWi T s Trtan.'.lr. 2, <v <W 

nana -Fte«*w.2, n , pi 

I'.nnl In lnini. I, 2, 6. 
I'-.lvn ,-ni.l v ,|., ,.-r : i-. 

r.wls Preiicliiiit, .. _'.■■-■ 
Primi >tfiiTitvv ' l 7Q 
ratlin Main;, 2, II, lid 
QuUt Ptnatt 2 12, 105 
Ki-.i.i Lin "in*;. I, I, 47 

Ki'll 1 2 11 hi'! !■■ I'-.i: ini1>jr, I. 4.0/{wc 

■■■-.i::; :. 2 i l.i 

Rem iricir»r>', 2, *!, 97 
Rcvu'litiupurv Att. I, ■ . 7: 
R.-Hjinjr l>ispbv ,lftKi. ', 10, 179 
RihviR JIjkI. J, 2. 12*7 
K,W Irit+tf, 2. 4 72 
tSMslln l"«i, 2.4.41 
ScltcM Rimnioto i, i.fi 



Sena Anisi, I, \ 79 
,Sfr«i Huh i+ 4KL 2, 10. V. 
Scroll Oear 2, 1 1 , 1 1 I 
JifiOU Ruks (.6K 1 . 2,7, 91 
Stawci A iVrt-oy (iKi, 3, 4, 133 

fc.t, l i .a.. J RcjjIjlv:, 2 fi, A? 

ftairiTV -Jumlwfi. 1. 5, 7. 

Staeli Pad, 1, 2, 1*5 

Shafcc, .5. 2, il9 {?ee mrrrfti-un, 3. 5. 3d) 

SlMkc.4, l r 179 

SlJMll Enlcrpnsc, 2, Vt, 8Z 

Sfiimd AiHlyu II SJi 1, 5, 165 

!tfun4^ nf Alorm, 2, S. $$ (set 

CArKCiioiu l y 10, 15| 

S(>i<;c Mining. \, 1, It5 

SjwtJ BjII, 2, P. HI (Wfrixtiom 2, 10, 

IV 

Speed Iknll, !, 1,115 

Spiral Unit. 2, EI, II) 

A. km* inf 1n.nl 11W, 2, 10. M 
S'Llj;ij.f Txlll iqiK, 2, I, (W 

Sjhnuimr. 2, IUU9 
Sjrm'jnd, 2, 7, 9V 
SJffdinJtd tl<3K), *, 1, 1(1 
S«p. 3, T . Id tooiiKtipnn 3,9, 39} 
THW A uack [IfiK t 1, 8, 158 
les^rinf Aid(lfilt), I, ?„ S3 
TcleuapeMoJcltiig, 2, 2,74 
'text 'juiifirraicin 4,3, 1 35 
[hrni 1 in(ir[l(,K), 2. 2, (-7 
The munch, I, 1, 67 
Ihr Real Wuild, (1 rjK}, 2, 12, 99 
The Wall flGK), \ i, 137 
'llirci: Gjme*. 2. 12. W 

ln;hr Sccnntr, 3, 1, IIS 
TraJe, 4. J, 175 
Trai»-KHii? Mn»u I, 5, 78 
Tunrtd (JK), I, I I, 2C7 
lu(1x(l6K,). I, 3, 121 
Ihe2* lire Screes, 2, 2, 71 
tVtdn €ir, 2, 1(1,95 
Wliiit T>ui DrKToyar, I, 1, ■ S 
Wild 7Jnj;i, 2, I, 70 
Wiiu!toill>,(tfK), 2, 9j_ 97 
Winning ^e<iujnv«. 3, >, fl' 
VTurilPuule (l*.Kl, 2, 10,94 {we 
wmwknu 2, 12, 19) 

VCorrj Maze, <I6K), 3,1, 107 

i.\:i|in: ,-',,:■. i.Ki. i. b, 1(3 

Vtkki WfiHip, 2, 1,67 

ZKrtbin, 4, 2, 193 

BPAn. i |, tJJ 

Satkwarc Survey, 2, 2, 24 

Stltutrc uivcy-, 3,4, 40 

SvIluii-: ttmp 2, I 1,36 

/."■J SiAwiic ,nrt(, 2,3, «U 

Sen inf;, ., 4, 37 

Speech IV iirt-iliui» 4,6, 43), 4, 5, 125 

Sprite Maker (lUM- I'Ar-n-f I in* 1, II, 

4% -J, 9, it 

Tie 7\H| and PKalel, 4 6, M 
T«allJt, ?_ ! I, 76 

KXTBA rids 't'oi (-• pmicn, 3, I, &i 
XX Memtry PmI*. 7, 3, It. 

7-X Slrinps, I, 1, II 

ZXfll 1 nisi.- 

^iemnlci | 4, ! 1, Ml 

Backup, 4, 7, !52 

Bahble S*tl, % 12, (fll 

CiucPi PiEs--, 1, a l« (HtW ROM 

iw(l«! W* ^uiriiijliini S, 1(, 46} 

Ostein: l-atvls. *, 1, 201 

<lijnc!cr .Vfiicr, 4, 4, 19 

(.Jumpier :, 1,7, IJ9 

Ctatpla r, !,«, 77 

Cimpii'i ., i, •>, 1 1 ■> 

C»p7- F^fitTii»p% 4, 1, LiH 

fiHacie |ipn:wkh<ti), 1, 2, lid 

Liitjsscmhkf, J, 7, 56 

lllaw, J, 12, 145 

Draw 'tmilmi- ,>m j(trr;ci icr J '1. J. 44), 

1.2. 1)7 

litofopcal Mudellias, 2. fl, 46 

ELUL-atwa, 2, I. I 1 / 

Hod Up l>inji IJT, 4. f, 121 

llitjh Ilea, 1, 12, 113 (uurret'liw* 5, I, 

41) 

ljjikAC , 2,9,« 

\*i, ln»C <jyde UUilor. 2, *. 75 

Mlflk S,,n ■,:,•■„ 2, r , li 

Ma«e, 3. 11, 1*9 (bnrr^htif, I. I. >2i 

Mjlltlm: Btlflt, 3 I. (44 

r.| ; ,iif(1tK). =s _ ■ i 171 

;■,!■..;■.:•..., ii ■ i;i: i-i 

?, 12), i, i, 1^1 

QukUlHd, 3, ft, 75 

Ra-iuirt^c:. 1, II, t>3 

.5r fdelrte, 1. 3. IS3 

Speech (oxreaoos I, 6, 43', 4, 3, 125 

S^nlc V.akrf (wr * mi ectui£i« 4, II, (0), 

1.9. J, 6 

I ijh VbtM] . t. ; i. "5 

Ten taltiu'., ijij H>5 

llniiUe, J, 1, 6*{s<:i eotteAiinf 3. «. i r o 

VT»rd rrrjcwwi (){iKX .', IP, 3: 

?Xfll SlXvirin-. l.-xitimri J, (2, !70 

Voice itcv)j;nilion 4, 111, 1|) 



I3C TUUHCOMPUTEF MARCH 995, 



rele 

-3PV 
UNTER 



THE ABCADE WINNERS 



THE OFFICIAL HOME VERSION OF 
UU.Y MIDWAY'S ARCADE HIT 

• You contra! the In bo charge] race 
car/tiyd'O spy boat 

• You conlrol a aesiiy irsenai si 
missiles, machine 3 urn, oil slicks and 
smfike screens 

• Soph irtlciled spy- chal leigi rg 
graphics- 



&2 



f cr- 



u.S, Gold Is stocked by 

:ig'7iflM!r-W!l WILDINGS 

IWKM.WOffTW.WHSM! I H. 

Rumbelowi 
and Spectrum Stops 



NEW! 



* 



/ 



\ 



: ? 



/ 



DTTlClft!. 



V! 



sfedl 



ofr 



%4 



gj& 



/ 



COMMODORE 



L 



SsE 



iiu^C'v 



^*s 






^, 



lufacturersfor 






«$? 



4eatc schedule arid trade 

ptiftKLJhe Parkway hdu? 



A» 






12 95 



SPECTRUM 
CASSETTE 

795 



i. Hene 



JLBinningr'ann B7 4L^^i 



>;C21*359; 



Telex: 337268. 



ra 






■»_ 



**~t. 






*-*... 






H 




w 









E 



■ 







#1 



B 



/s 



BES 

NOT SORRY 




l iiubi (i I mg 

umana 

ipprovaf 



So new you have got your home computer, you're ready to talk 
to C j it ana - tha best n a ma in memory. Already a market 
leader throughout Europe fur llieii range of d skdrives, 
Cumana now iave other products on offer al to the 
ssmfl exacting standards that have made their 
disk drives the number one choice in the 
home and in education. 




/ The Touch Pad 

The Touch Pad is a low-cost graphic 
plotting aid tor the BBC micro. This 
compact display cursor moving device 
simplifies programming with the touch of the 
sty us. 

The product comes complete with an instruction 
oooklet, basic software, stylus and connecting cable. 
Its uses are in graphics, computer aided design, 
education arid qames. 



£69.95 

including VAT. 




^3^ur65 




Disk Drives 

Cumana have spent years on 
research, revftlmn-pnt and marketing 
a range of drives second to none. 
Their drives a*e compatible with BBC, 
Spectrum, Dragon, One, Tandy 
Mcdets II anc 4 and Video Genie. 
They are fully guarantiee for n. 
months and aDproved for electrical 



safety oy the C.M.E.E. and are 
extensively used in GLC and ILEA 
establishments. Cumana were trie 
fi st independent disk drive supplier 
and are now Europe's market leader. 
Their products have been preven in 
the schools, universities and homes 
throughout Europe. Let us drive you in 
the right direction, send now for 
further details of the CuTiana range, 
O" see them at our distributors and at 
selected bralches of W.H, Smith, 
Laskys, Gieens, Curr ys t and 
Spectrum UK, 








The Acorn Electron Computer 
A microcomputer wilh a proven frank rftcori Using 
BBC Basic, the E eclron was developed out of the 
Micro that has been chosen for over 80% of school s 
participa:mg in the Government's currert Micros In 
Schools project. It connects into almost any TV set 
and cassetta player and is supplied with a 
comprehensive Lser Guide which runs through, in 
a simple to follow manner, ths basic principles of 
programming A wide range a? sofware is available, 
including games, 
educational peckagfts 
and home 
accounts. 

Cumana price 

£199.00 




Disk interface now available 

for the £con Electron deta Is from Cumana. 



Diskettes 

Only when Cumana found a double ■, 

dens ty diskette up to their stringsn! ' 

quality control requirements, and at a 

price that made sense to the end user. 

were Cumana ready to put their name 

tort. 

Tferesjlt was a lop quality diskette, ; 
complele with a plastic protective a 
case for tha ten-pask (they are also 
sold in two-packs!) together with 
index stickers, 

Cumana d sketles are aval lab e nov/ 
in both b l M inch and 3 l fz incn as 
single or double-sided, 40 or SO track, 

from your tacal computer dealer. Don't 
trust it to chance, go for the best name 
on record 



LrimUiitaHbtj M*rcicL<npLLEM tiyTif-dlidi: iiirK ni Yea 
M)U I (hkq lit! 

CwMW4dL<J> drills a jpplud VrlLh fvmaltn^ d.'..M.Hi. 
drrsro titrfiO*; LliFicp --Civile tifiti Cu"wvir,n Liocr qitnlc 

lri*penHmf powcrf si p-|>l>. mini kad *nd moulied 
pliic included. 

f!Rinfl JTl fork 4itqifnUM (WW, 
CS200C JU ~rach dOUtMOtidCK. (50JKJ 
C.SI'OO iO Tr*e« onjle $id?n (JOOK) 
CSt 00 60 Trie* double iideiJ (HOC*) 

CD3C0 I x 40 Tru:k vngtesidtd ^iMJH; 

CD*WJ/& 2 3! W> IfltfcSififi* sited :*[WK) 
cnniHi-J 2 >A»'invhilvUj4e'wihriJ(l>(H)K; 

Climann diiV drt*J vulhindej: endifit go wet supply, 
mans tead and flog, ;*cix)mj oltu* jeeovsorws. 

C5<OQE4D HcksirVfil* soed ( I0CK) 1H9.9S 

CSiDOEO 4t< Ttatk d<*iW< sided (2QQK| I19S.9S 

CSJ00E 60 "wc* SiFKgld 'j d*d (20tK> 118C.9S 

CC'OOE 09 "iscfc <loobl« .-i*k (4D<34<) 1208-95 

Curtail dish drufls suppled with bmwtkig distell* 
and Cunanaustr guide. Powc supply iRken fro-n 
SOC M*'ocemp*ler. *nth|*ad njpa-iw.. 

CSX 10CO 4f T*,**h si afli* s.*n i (ICOK) 
CSX2tii<0 40 Va:fc *4ib!* S|d*a t2MKJ 
csssQagaTi?*! sinjic*dfldi;MOK} 
CSX40'J £10 ftac! tkmtile -tided HCOKj 
3 'A INCH DRIVES 
CSjOBt 40 lac* swale sded* iMK) 
csxas- &o Tf«k double v<tt*t f4<8K| 

C D.<35; £ x 40 1 attained ai-lud 12DIK) 

CD OSS 2 »S0 D&uttJ mcod (BOOH) 

Tl» 'X' anyj IdUcs Hi piu«BI hum yuuii<i*_iLii-Lni|ju e> 

CSSS 1 iO Tf ack ti ng It gjced ( (OOKy C1 6». 95 

CSS54 50 Tract JouUe -Si-^-d 400*1 E223.&S 

CO J&a 3val 40 lUcKamcIo >Jan :;'umi< » ..^m ml- 

CDjfift SoalSO Tf.ich ctoust* sidurf (flOflK) f4*i.&5 
The 'C£' r^rje-conicSiCCimplerp *ih p? woe supply. 

DISTRIBUTORS/RETAIL 

Available from the tallowing retail oui els; 
W.H.Srniih, v-ohn Lewis Paffnership. 
Graers Leisure. Laskys. Specrrum UK 

Atoa di&lributorfi: 

Adtfona Ltd (Southampton! 0703 34 7 75/6. 

Audio & Compuiar Centre Lid (Jersey) 

0531 7-10^0. Eltec Home & 6L.fiiness' 
Ccmpute-5 (3radf0.'d} 327* 722512, 
Fai r hurst I nstru marts (Wilms0w'i0625 
526634. HCCS Associates (Gateshead) 

0532 921324, Hjgl"-SymcriS DiS'ribution 
Services Ltd (Bournmouth) 02022S53f. 
KinQftnin n*ftiQri (Belfast) 0232 6437 2C, 
Lightning ( H ar row ) 1 569 5255 . Mic roag e 
Di5tritJUton Ltd ;Narlti Lordon) 01 205 
7588, Micioworlb (EdiiitJUfOh 031 228 
1111 . Manorial Mcro Centre (Stockport) 0(>i 
429 80&C, lysrtr^ntjer PLC (Che&singori), 
Silicon EiorasslLetcestei) 053337491Z 
Ti-onipscn C<xik DfetrSHttkjn _t$ 
(B»Fnmngham}051 328 3895, J S. Smrell 
Computers (Kinaston-upon-Thanes) 

01 541 1495 

I Malarial Dealer network 




CUMANA 



«■ 



Cunana L mi led. Pines Trading Estate. 

BlUdd Slltel. Qu Idfvi'J, 5m n.->. G J3 2DH 

Telephone 0483 503121 



AH prices inclusive -ct VAT. 
AH 80 Track 5 i* Drives sre 
Swli enable to 40 Track Mode 



YOU MAEVELLED AT BEACH-HEAD... 
NOWACCESS PRESENT THMRLMEST MASTERPIECE: 



TT 




T 




ft. ; > ft ± *■ 

.TV 4111* .Y. "^ * 



«* A"! J «Ti 

♦ ^fflffiliiifl- 



The most breathtaking 
3-Dgranhicsvetseenon 



STATUS: KErtDV 



crnfff: neMO 



Gripping arcade action 

jljl Multiple scrolling 
*8 screens 



VtB 



V 
UCRT 

ftnnnrtc * « 



Tfia Soviets 
auiGh a nuclear 

ajcr 
"(tos in the Uni'ed 
States and Canada 
With our own 
nuclear arsenal 
•nattlsd/n 
accordance with t 
SalUVArrrs 

Agu- ■ 

Soviets believe 'heirtreacftery will lead to 

total world domination. Cur only i xir 

space station equipped with stealth 

bombers v which can fly undetected in Soviet 

airspace. 

As squadron leader you must lead your 
conrnandosooa virtual suicide mission 
krtcck out ttia Soviet launch eitee, and thsn K 
proved into the city of Moscow. Armed with only the 
weapons you can carry, you mu3t seek and destroy tre 
Go^ iet defence cent nelosLu j Die attack I Top multi- 
screen act son t 



ftU j ■ in* 



m 



A1 !** [ 



CASSETTE* 



*9' 98 m SK q2 ,9S 







y^ 





#$* 






iB * ^l?* 9 ® 




I 



U.S. Gold is slocked by all leading 

computer RtnrAR including: 

BOOTS WH SMITH JOHN NlENZtES 

WILDINGS WOOLWOftTH 






■ 



Dealers! For information on how to become a U.S. Gold Stockist write to: CenlreSoft, Unit to. 
The Parkway Industrial Centre. Heneage Street. Birmingham R7 41 Y Telephone: 021-359 3030. Telex: 337268. 



THE TYPING MASTER 

(The Keyboard Skills program that puts you in a 
<lass of your own) 

• The Typing Master' prcgrarn exist? to teach »qu to type. The 

■>&i\f met target is 30 words per nitrldCe with 95^o accuracy slier" 30 
-lalf-hour sessions. Trie fol owing ''at II ties help you ta accomplish this 

• ' Sight fi Type 1 introdjeci you to the keyboard witi the correct 
Finger far each key and takes you to i speed of irotind 12 words psr 
nintite. 

• 'Tovch Typlnf" ta*cs your jpetd to around 24 ™or^i psr ninuto 
it ne siifl* tine ensuring thit you learn the peripheral keys 10 tftc 
sama mnd;rd is chose more corrmoily usee. 

• "Practice Exercises' gves Nov! imec actura:y oriented exercises 

and Timed speed .'accuracy exercises. Your results are given In .vards 
per minjte ind percent aeturaiy, The target itanJard of 30 words per 
minute (and far be*ondj it achieved with Jiis module. 

• 'Session Monitor 1 overlays the whole pr^grim to hold /our hand 
all tie way through, the courc* Fram fint use of the program t- chat 
final, very useful result, 

• To back up this Basic version vol gc. docunientacicn or> hc*w to 
approach cr« course end a record cure tc fill In a; you pregren tHreujh 

the seldom. 

• The Typing Muter' is lot a tsy. It is a prolessianily-writEin 
program which has as its sole purpose the te;ching or' typing'kcyboard 
skilli in a way thtt is friindly and fun, It *ai wrtte.n by a typiig 
instructor ind it fias beer marketed world-wide or CF/'M, MJDCS. 
PCDOS and ethe- operating system-baic-d machines over the past 
three years. It has alss been available on IMcwbrain and BlC Mk-o 
(Mcdel A or B] for over a year ard Is now being released for Amstrsd 
CPC {mono ui kioour), Con-nn-ocore &4 ind Sinclair QL! 

• TAPE fcrrniti of the Basic version are aviilable from the fol'owing 
selected list of distributor! (m:dia and prices arc shown in traclsecs''. 

NEWBRAIN (Caaecve: £15.00 Jno VAT))l 

GFG Microsys:ems h 36 Armltag* Way, King's Hedges, Cambridge, 

CB4 2UE. Tal. (0^23) J1HM. 

BBC MICRO (model A or 6) (Cassette, usabl? with disk: 

£15. 00 + VAT) 

AMSTRAD CPC (mine or Colour) i Cassette: £15.00 + VAT). 

E.C.H. Hobday. The Chestnuts, Rodm^rsfiani, Sittingboirne, Ksnc 

ME? OPL Tel, (0795)24191. 

COMMODORE 64 (Cjjkiub. £13.00 1- VAT), 

SINCLAIR QL (Cartrid|c: £20.30 + VATi. 

P, AshciteL 36 Athlone Avenue, fiury, Lancashire, BL9 SEE, Tel {04? t- 

757) S2I4. 



Please *end me_ 

(Basic Version 

far the 



.copies of THE TYPING MASTER 



per cosy (+ VAT 

whet-t.i Jinwn) I ^rt^lriu* f hr-^np ,pfK»l nrfW far rnfil nmnnnr- 



_coTipi ter at £_ 



NAME. 



ADDRESS; 



PlEaJI SEND "ME ^OHPtETED CCSUfOH AND PAYMENT CIRECT TO'IHE 
DKTRIflUTOH FO* YOUR COHPVIW AS 5HQWH ABOVE 

• CliK b#ma! of tli« liiii propBmiMy »? Eihnin?4'rnniThFlellfl'vinj(iiippli{r>, "he, 1 ilw 

mpfJf l fajIHUB-'Stheoll vznim whirl infnrpnrnrri rirrsrc! krp|tn^ jr.d irony drier lidliiiei 

PVkcl lh*«,n kclew V* tor liw Hjuc vrnim 

APRICOT. SlRIUS A VICTOR I [iibrsd <et!iib). |Dbi. iSO.OO + VA 1 •,. 

Anjl.1 P..i,nr-'. Cnnputrn. I M,l-.3n Disari. Iu.'nbn4>i:, C6i4 I U1 Trl. jCIJ3| 3 I SJ80. 

CP.'HBO. CPMIt. MSD05. PCDOS. lUik. iSU.OB * VAT.. 

Mic-oronpmir Krcducli IntcrnjSnnil Limicd, Cin'jjl huuit. Ciilbl «J» flaid, Bl'lfllit. 

ENU. IGil BNI Tel 11\ i1\[ till 

or, 

tmllinnllliiilll. No. : Aliu C-*in T«dina4«c Cftr*, 2J> 65i«»ll H,?**. .tx«bri, EC I, 
f.1. |OI-i33| 1173. 



fn tri* C 1 SifciA 1 ^ wnriif 



ANTHONT ASHPITEL SOFTWARE SYSTEMS 

56 London Road. Harleston, Norfolk, IP20 9BI r 

England. TeL {0179) 852807 (answer phone). 



BETA BASIC 1.8 

ENHANCED BASIC FOR SPECTRUM 48K 

FOR GRAPHICS - STRUCTURED PROGRAMMING 
- DATA HANDLING 

R*_- r.-in-i 1 H i". rnmn punndu' 11-ij ■ irWrtl V/i: il'ini li.ivc :.[>. i:<- liMlfi HilA (itti^rJiHi 
■u&icc — \f VW can* I Mqv« llic ad, w a d ub m teua S.A.t. Jtw luilsliet 

in1irn-K*iim 

Ftfiig^es: Com«na*ics me aiioleenlrv ktyworda m paoMcs mDde. Synraic u 
cheeted on entry. FjHv lampBTTtle Ai'h Spectrum Basic. Microdriv* combat blp. 
Cooi|>rrhcn-jpvc mnarual- 

NCTE: Releiie 1.0 ii stil evfiloble Po- 1&.-4&K Spcrfum d- ri 1 CK? 



ALltJl tfnurw r^ln.h'i 

•«v*i«i -■■ «j*iTrti 

Aljlig IHlWl*i »fc rtl *Mg 

■MJU "-j! nl . >-4« 1"; - 

tL#Bt* OflilTHJL CODTHI;* 

Kili^k 14 "*rt CI«*^Hi>iihk4ii* 

DT!JCIT'^»i 1* k-rtti* Iprb 

E4UTE ■ h^.h ^ lr%m 

DO .00* irmuit 

UH:*t 4n^n r-Ap 

Inr »iw. . M i- ■- 

fLt: Mir*- *.r i- Twtv^ 

LW1 i— rF rj|'il ,i;il' 



0Hlfll nMhn 10- f (r*>nw 

fi-r i-.i .-.- - 

C*C |ifcfc|*|bi--1ifl ^ItPral 



ALL *tk«UWi iv M *r* t,-»fy-»r1 r* 
VJMH 

FITII- ■ rttTin 

MlVOfiCnS ri- n HW«ft*nkHR 

LlfT(lKTUr.F II 'i - 

UlrtP ujp-i will iOTQ. &5JUT ■ 

OJM hr*.*^«» --rr r- - - 

F-.tr-^lhir STA"-pmd MJiL-«H 
nill ^ rflnifr IrriKf Lfi'iIi4- lJ'mI 

■_W"I-*J tHrdtl » 

n-rrM.i P .».. . 

f-r-r nti ppnr- r-Hfi ^l»f 
I'- ■ ■•-...»' E>fim<i«l 

FUNCTIONS 

niMW !■ «*g m I ■: 
WKJ">'».I .'M..-.J-, i •■!<■■ 

4* <>H hv ri-l 



InuMwBlif WMM 
HJU ■■ V »F « «r«* *- «» 

... _ - .... -,■•- ,-,...* 
IQHffll IHf II K I bri wl!M 4 
', .-. • 
alt HMIWtM 

i vwu f-J *-,* ™ht 

rfHI, I ■'- I H^h l?;in< i.l I •■' 
>6j- ril mm Ft^l .--j 



iHrM u,< nip 

TWt* ,„.— .],.«. 

OU 1*1,1 mr^tt, <i/4*'t 

1ft* '***,*■! 



Onlv ill, CO mcluiivirl lUp,jruda prcn lor FeltAIS 1,0 «V#ni*l ■» £4 00, T^t 
IncludH a 1 2'pftgp juppltrntnt to your mlnuil. Plittt quci# dlt* tt pu'tfvgH. II 

ytu did nal p Lithane 1rem JJ r itsie jucVpi^f £rvd return Of*iiria1 to&«;H* I 

PlJitO JCfil mt: 

Sir* Bo*ic. ReSiase 1.8 PBymern of CH 00 d rn;lQ-,eti 

tor C 1 1 .SO for Porftigr. ord*rtl. Ch»flu** f*v*M* » M'ASOFT. 



I Can't belifvl << iPl?#s«) wrtO mtrl^l l«l*M* "I Boll Bj.ul I H. 



tttdttt t tumped 



a inn -ss 



BETASOFT 

92 OXFORD ROAD, MOSEiEY, 

BIRMINGHAM B13 9SQ. 




REMEMBER 



I 






YOUR COMPUTER. MA=tCH 1985 135 



I 



*A€A 




THE KEYBOARD FOR ZX SPECTRUM COMPUTERS 



a* 



EASY FITTING 

* PLEASURE TO USE 

* LONG LASTING 

The Saga 1 Emperor, ecuipped with 67 keys, is a 
carefully designed replacementkeybcard incorporate 

ng many special ■unctions for the popular Spectrum 
-kxnpjter. For business or pleasure, the Emperor will 
-make ycur computing time more productive and 



enjoyable. The SAGA 1 Empsrcr will enable you to use 
the Spectrum ac a powcrf u program m ng toot eas»er 
and faster 

The sty e is easy:- fat your benefit, tie SAG£ 1 
Emperor has been designed to ensure that aveilabfe 
Spectrum Peri pi era Is will fit in tie usjal manner. 

The assembly of the keyboard issmpts aid 
fast. No sokterng required so that within just 5 
m nutes you can replace ycur current ZX Spectrum 
with the new SAGA 1 E-nperar 

AND ALL THIS FOR JUST £54,95 (inc. VAT) 



J 



SAGA PC i 

Kbtir wev own PbrfeDOfli Carrier iarn- 

•run. Saga 1 Emperor boo ptriphnr.tl- 
fape Recwden, Rower SippU Cabtai 

rranuals ard UrcbclUK. 0" sole an! 
HKracr:iwec3nSTue^anthiRC isniealtar 
etonng arm trflnsj>wt*ig you- comsuttr 
acr,essnripft The tasc ugci 3 strong 

dcublr. Mhtr.hwti ai 11S Liuuii'J BdL;k CjI' Viri^i 
with a C(HH]h th.r.k ARS inner 20frp«1- 
mert. leather tm-klfK arri a strong * and 10 
Onty £ae.as Ik;, wan. 

DUSTCCVEB 

AnuJiet'Lcg quckty ztrcAxX. this experty 
|w^rii''i*< kr^C'lastng Snurd and u«wn 
thjsiccvfir his teen specifically flesSqrer) 
for We SAGA 1 Emperor g/seh wil itwri 
evsryth ing to* ir g mat end oustlrea Grey 
£«J3 ine. '/a 1.. 




SOUNtMDOVT 

He*- Ijhtt **Y5«Hl eiC* 

*** SACA ■3CUNO0CKW 
The GfiGA SXlMDfifflTSl «i • Un efc- 
T.-Di u L -^u.t,vr rh ^n- 'j.:-i.T_i4,-i'rT»ancra 
triutounj vnunin r'n 'p-iii ■ y-eSoe: 
trjn tcdinri r.- ji i ji. fl.Jii -Lusdc 1~^*m a 
wtwiper Ki a nciar, LIil- bUUN DEIjOCT £y) ■ 
■.•trier; w.'lfn- 11. cl- .i'.u uji'iIf— ■«■! 
ipni* [Utyvifj Uf'tl SKL-ity *.t p-g-an- 
..«.». IMMf tut Knvb*w4 Ctwh'l. Me sue 
■^ ?-"j -Jhtwing P'M c a ■ t«cc 
(>'t taSC(nc v*T) 

1 A-v'i.'ut-j to rei«uii veur -jftcttrun l«m 

ji ly .i,--,n.1 ji sji r g tl' # r.. !j. " ■-. ' 
^V r"" l P'. , ki r dK rT " and wi ^Aw 4iA-4» Imv *V 
wans or Ll^u 3 irth rLEfflGWlfc <*j*i:fc 
W Sjit vjjt teed= 

fcl.Hr fw^rHLEHICWUE- £1*** 
rii^i riind>nrriffl«nT - r* eo 



THE COLLECTION 

COLLECTIDM 1 - SAVE £10.00!! 

1 l C53.B5 

Our ap*ci=i I prr s E43.B5 
i'vIuub* 3d-jdFYi*>uimi..u«-H!- £14.93 
3n'jr'1huTf,t, £3. SO 



■"■ ' . ' i" "i"|'- ••*'. k* . ,i- i .'-I >:.'■ ,-■ *n ■ 

1*f( «Lv i»J--r vnufe Kitviti i»dM>(»»tj:Li - to ttci it 



COLLECTIOM 2 - SAVE E2D.03!! 
rr^ itiae.«D 

Qjrivpf?[,in ..i i! ■■ CBtAC 

" „ i I ■ i ■ i 1 1 . -jr 



E53.B5 

csa.ss 



COLl£CT»0N 3 - SAVE £30.00!* 
rrj? ram 75 

..: .i'lff C20I.75 

r TDH.FQ 



Ourw«mi P 1 tr ."- £ SO* .7 5 
Ccll»r.DHin £ 
j 1BK E liar 
IX SlKLTJlT. 



DISTRIBUTOR & 

TRADE ENOUmiES 

CALL NOW ON 

WOKING (04862)22322 



Ptaasft *nta co SA jA Systems Lvr^tct. 
Oex. E E y# Rosd Wokira Surrey 

Tekohone Wok noD^B63fiflSP7'??fl?? 
or ~e««jt 6S9^a 

All jrices induce VAT 

PiV *rf-pi f i 1 r 5r.i jn r BcKJSC artd rtawiflljfe, 
PSPC'.E5rari3AeA'.Si.|«iu UK. 
£4.00 -or SALSA 1 EmpftrfirEuPftpa 
Lj_15.no for SAGA 1 fcrnparorUAE. 



Please send ire 

Name. 

Addrc i'j , 



"K^ — 



£«9.S5 



n 



TTe folOwfKj SAGAPRDDUCn; 



Tota tniounl enclosec E 

Wtessc Me CHEQDES'P.D Ptyutn'e to SfiGA Sysiatnx Ltf. 




STOP PRESS . 
M STOP PRESS 

^^ NEW FRIC3 £49.95 - ?&>P 



REMAINDER STOCK CLEARANCE SAGA P.C. SLASHED £14.95 . 
. SAGA 1 EMPEROR ALSO COMPATIBLE WITH SPECTRUM f M 



STATE FOR WHICH MACHINE, 



RSD Connections Ltd 



V»lTH { ,tC TfUfi 
ICC* 11*3 fl%V& 



fcliB-j^il ft-jli* 



ALL1 MilHt LC.M 
BH 

flfl~ 'Wifll 

.l^filfUB 

VlEVlOTiXH 

IBMPtHL 
SPICTRjM n.| B rH,^ e 

1 UP&S32 
^p-'"Hi;-r, .--.-.i-,-^ 

. i tCtmWci 
KWWMCSw 
L« .nancs 

UL 



fi-H 

t».ts 

f H ! 5 
l l h >, 

ni <-j 

MS.'iS 
[IB ES 

La J* 
r in 1-5 

. i'j ,..: 
I i ■ ', 
It ■!, 



!L-i.il ! 1. ■' 
S i.m.i i- h.1 



LUCHtADERS 



T'ri 

ia 

1(1 

3* 
It 



11 ou 

H.40 

Dli 

t2.i* 



TbiE*H3NE':0»(fcS 



LlL.il CM'Irl lllljill'.' 14.3ft 

Lircii-t ';L^Jn:r ClJtfi 

H 1 |— L ,1, , 4tf r 

■< i (JH> ■.ril '--* |hi iTtl'M l&p 

Al SUrftdL-f Li.Yli - kfiLH l-mrCJ 1 JT" 

■iftirawii 



7 I,"- DLU -iUfS u ?iti.&irin 
In j Eh v- J m^ J I L.j- 13 26 

'.jJ L*t.ti Jit* ;'u^ 12 20 
ft Pin [UN f*-,nj In C* F*n 

rs in i ■ i i h-j 

?k3 irrfT-Jnc* plugs 1j 

7il Si'ir Ihi.iV i-ii irk "'i 

11.25 

7 Pin pfly jilnu 1 1 =■ | I'- 
ll IfJ |.. n ii'j'j 

7 »m DBSI^Iwi in SnnDl* 
ptjj ml 7 "inn. JjcV ulu| 

7 Pin [HN !>lua *e ? ftn 

<Xtlrw.r IIM 

4 An uhiu Pi^ -c 6 Bit 

OamnaiA.1 H.S5 

3**&wt n.| if. [uu;' I V 



FW.F CCHWC'OBS 



7|.T ^^iJuilulii EZ.1D 

7iF iv^^iwimyln^ El ?Q 

Jilimrv I * L'U 

SCH-Mf ME* U ■'LUG 

W1J.HP4 

IJIrlf V J Ml. I 1 J-J 

ta(;i'^n 26 #«v ll.W 



Mffeim3tL£*0L 






£2 Vj 



e.ni: 

Ul V 



TnUWEKTFNSILTN LEJUDE 



alii: V 



i ■' ii-i i-.: ii 

OSwr c hwj* i!4H ™*> (Oh* OH 



TRADE 
FSinillHUS 

WELCOME 






•Ebi^ I iTnnMnrfii u a , JHpi tf C J. "O 




THE 
MICRO WORKSHOP 

MICRO COMPUTER 
SPECIALISTS 

(Spectrum Group Member) 

Software and hardware ov^r the counter for 
Sinclair Spec:njm, ZX-81, BBC,. Vic-20 r CBAl-fi4 5 
MciriOtcchj Amstrad, etc. 

* COMPUTERS * RAiViFACKS 

* JOYSTICKS * BOOKS 

* KEYBOARDS * DISCS 

* TAPES * LIGHT PENS 

* COMPONENTS * 

Buiinessf Serious Program s available 

Located directly opposite Epsom Main Line 

Station. Visit lis or ring far frbndly service. See 

and try before you buy. 

Ovcrscas/Eitpon orders welcome 

12 STATION APPROACH 

EPSOM, SURREY. 

EPSOM 21533 




YOUFCCMPUrER MARCH 1385 127 




The talkof Britain's 

computers. 

The Protek 12Q0 Modems bring yoi high speed compute - to compUerconnmunkattot ecu pled 

'-•jith the ability to receive and transmit .o databases set up for the 120C'^?3 Daud InteindJOiidl 

Standard e.g. Preitelanc B.~. Cald. The Moderns will improve your business ccmmunicatoriiat i very 

low coit — From £5995 the Modem* are available in two models. 

Majfc l-l300;7&Ful!Dujlei: 1200/ 1200 Half Duple* *2*.ito, 

Mark 11-1200/75 Ful Duplex: 12O0/T2O0 Half Duplex ircfudinc lire tUTiaraund facility i?995. 

You will fir d t hat h e* are th* cheapest acoustic Atod em s on he market No modifier lions tn 
your Lflepione are necessary because the Prolek 1700 fVodemsaredejignedlofit most itardanj 
telephones except urn phones . S ~ \ 

Ad ded to Ih i b the co m p uteri liri ted by M n<\ pm* n m»H iot pwr be the /ftp prove C 

same. TheMedems ere compatblewilh al computers using the industry 
standard FS232C interface support ng a split Baud rate. 

Fulty portable, simply opsntcd by 4 AA batteries with LC3 
indicator— all you have to do toma.ee contact is d al. ^^ 

Protek Computing ltd, lAYflungSqu^c, " "_^ ^ ^^^mw> 

Eracefidd Industrial Park, Livingston, West LothUn, Q5W 415353, Telex No. 7275=9. J ^ f^ 



Iff 0J*Awtthtel*i6ftrrL'iV;,-t»n 

\>nrm, r^r sL fcllllh. lelrtenrtlu-f .itnllt il 

■it r->r(l jk\ H [ht e.tAiifa?\ iiUhr 



I3fl YDUR COMPUTER, MA^CH 1985 




ELEPHANT NEVER FORGETS 



Get the best from your computer with ELEFHMT disks. Certified 1 OC% error-free and problem- 
ires, and with qualitymaintair.ee for at least 18 million passes, ELEPIIA1TT disks are 
guaranteed 'to meet or exceed every industry standard and are compatible vrith virtually every 

computer on the market, 

Look For the ELEPHAM 1 sign at your local Dealers - or in case cf dffrculty, 
phone or write direct to Dennison Manufacturing Co, Ltd, 




Dwmben 




Dennison Manufacturing Co. Ltd, 

wiWsy.Wattod Hats WB 4JY.T»j Wattorf OSSS) LlB« r TSJw; W33SJ 
Franco v: kmUw.8 ^;* Urtn^oifttr -.93L15»rtMtiy'ScHH-S*». T*t 18 { L'l 6B5-73-M 

Ctrnifl/: Uu .-Mi&mjKiei^itBiWrOm^H.FWiti^WSLr.aaL 30C0 Humc7?r 1 ?£1bk: 33381a 

Other C«uifci?5 «L:waaumiaICDiinaiii(.4006£rkr3Slil Itatth ag.-C uidl I I "'.Mei SSBBSZiD 



fMllAerobcitics 
3-D Graphics 






.****** 



HOT 



W 1 



r ^ 




x- 



\ 













DISK/CASSETTE 



iV 









,'■ 






F-15 Strike Eagll 
features superb 3*D graph 
F-15 manoeu v re a bi ': ity. ccm 
assisted targetfjric including^ 
fignter Heads Gp Display, airborne 
air to air missiles, surface to air missile 
tefence, yround .aiyel bunibiny, full atji 
batics, arid midtiplecombatscenaric 



£14.95 







- vf 



y - > 




SOLO FLIGHT: iskeofl wilti'.liisuMjrfiimdlv (light 
simulator * ht-ch includes 3 D graphics, full cochpil 
it sir.irni?n;nri3n, iju«i: VOEs, II -5. 7, 1 (I frerenT f irpcrts. 
and real Hie c ia.l«;igs Ire m weatJi er and m m h a i ii .*l 
cpnergumcies. DISK/CASSETTE £14, 95 

SPIT FIRE ACE: -Save London durrtg rte Hittn 
yoif R*iFSp3ti re! Ot i tstij ndi nsj o ii E -r)r-; her- cock fi' 
,M>gnphi;s: 14 dtttrsni combat itnsrlos. 
D. 3 K £ I '£ . 9 5 , <J A&bETT t &9 .9 5 

NATO COW4ANDCRI 3ef>nd Euro* in an 

■icri?lenat'-d real-time *ar ^ttucUcurt! Fkil saolmq 
Sattte map. iicluies ntaotry. armour, 
!' i 'I i: :;[jliTi r utrfori:c) ji id I JiiJLji i likJl-j! 



(J, 3. Gold is stocked by all tending 

computer stores including: 



Fjgpp *JJ.l,!.IJJ,li?H WHSMITH WILDINGS WOOLWORTH 

U.S. Go.d Limned. Unit 10. The Parkway industrial Centre. Heneage Stree;, birmingrian tiV 4LY. telephone: 021*3^9 MW. letex: J J ^66. 





CLASSIFIED 



661 3036 

Contact: Susan Platts 



ADVERTISEMENT RATES 



Copy Dale vtorch2£tf 



Lineage: SOp per word 
(Mtn20wcrds) 
Box No £4 00 extra 
Lhetce advertisements are 
prepayable and the ore or (or in 
published m this section should 
be completed and returned 
with rerttttance. Credit Cord 
foeili'ies ore avoiloble. 



Deploy — rotes per sec (Mn. 2scc) 

One insertion s £9.00 

Three insertions £8.70 

Six hi-, (.'i 11 on:, £8.50 

Twelvj insertions £8 00 
Display advertisers should 
preferably reserve space by phone. 



Cbsm:; djle for Clossilied 
a tlvKt lisenenl* u Ihe 2jfh 
Mcrcn fo 1 1 he May edition 

Post to 

Your LornpLter. Classified 
Deport men 1 Room H2tl, 
Quadrant House, The Quadrant, 
Sutlon. Surrey SM2 5AS. 



Britain's Biggest Selling Home Computer Magazine, 



SINCLAIR 
SERVICE CENTRE 

We- have (he syj'L'i lui j ; i it^jr:. 

trs: SlMCtrun, 1X8 < Printer cind 

RAM Park. You p*» CIO- Oil r"JK 
pans and return oostage. All un is 
ftipaiad in ongiral Standard using 

tiji'ij.iiij SiriLiuir Sfiuiui L/ J.J' 

H.N.C. qualified staff Alto 

jVEiilibki 5per.tr tin rV«mnry UpdnfH 

18K.10K titled by u* £26.50. 

QUANTUM. J3 City Arcade, 

CivCnfry ur Riuiej C-a wk-i try 

(0203124632. «. 



vic-a I skks: 

Cartridge anl Cmett* &**W> I* 
Tvnyttui Liiitf x nivtinin^lii; VK7TBIJ< 
dirt,) IppipNi-I /Uso CfflMns 

hforiwtiltn rn tddim RESfT, Rl "ll 
fDvuf Fl A Wi^TF PRGTFCT Axnldfo* 
Ift y<air VIC ■ ?■ 

Stnii F3.45) jump M(f ) p&p 

U. Piiks , 52 Laurie. Avenie, 

Foifil Field i. NettinjIiHi 

Ngtf lDr 

if/ait Ovrfei oniy pltast' 

113 



wAFADHive Micnoomve 

TRANSFER TAPES 



rimrtrr rna'oPty or y-mr jarrws trj .1 
WAFUDfllVE 31 J MtCRODRIV: umhj 
r.« 017 WD or duTMD tapli, T^w »■.,- 
He. Se^iAutcmati-, mitFoc wfich rw» 
tc^i |/*Oflvl Ik Lnr ii-y VQJt 3uv_n*M. 
t'Ctulcf (rj's'fr-ing o' Hsfldtiillit 

aroginnta fxr&ops \nirat wwi- 
"he Wftfjuirvc WiyVO «kJh)H iwlMm 

D fl-ctikr reduce t«»(brn |Ln« lc 
awkrpari arognms 

Loorjtf ptogpina (an be 1r.1n4.ll nod to 
Vt'AFWHVE *' MCMCfjnivc uitng ih« 

vil"iqin printed in N*wiP*t vi ul 
UlCflOCRrV" < EXCHANGE club.. 
st:HAHB(E. LOHiS OF MIDNKHT 
benl|f (wn; rijmpo 

W?wtj w rjg'MDw mitna 
EfJH 

(Europe + 5Dp Oltws -CISO- 



Mir.ROTRiVF. EXCHANGE IStWS 
LETTER CLUB, Vtannbrpr»hif> is just 
f6 'Of 12 manihly fnuet IfB 
Eurotw, £12 ehtf^here). Includes 
iransfmrigVU-FILE/CALC. sf . 



ZX GUARANTEED IYCI 

2*9 Cheddftrton Drive, 

Unsworthr Bury. Lares. 

BLS8NL,T B I 061-766 5712 



W5So'tWf«« 
U-. (fltt» I u lU Ot. C 1 »h Mki wtli t»»l 
Till p*d<*|« dim* vtglff-iify tan*^, 
njtfim? Or t»«te!i(V l»( f-lrt. mJlipc 

farming «l esiridflH. iitd *jic lac»i.p 
al l**t tnn im a> «*■* tifi"(tj** w 
dr«h«r w* dpdoiMl >f«i v«i|i 19 ol 
Al m*HhM.ltl SidWwi, 4 4if«W<vd 60 - 
fii** on b* *i»wM millHul Kittr 
nuprllnw un * VtniFV r"o;ir»m *i 
ur?iec*iStl¥ - Q0CS h)4«.« th * 
HiTOrtiiTitilv, Sow Incudlf lUfKIOry 
p^m-oui *nd 'qerini' «i crm ir,y or m Mt» 
« • arSMCo wiih e.pi e-,i, caitd rinei 
Owmj-j u1 lhu L-iilifi ?uL-i jrji.- ten updvf- 
ttt w^jiifi ^U^ tufi Ki|]L<And 2Ep 

Mori* T jtct lo r 0L Ct SO 
A* for 44K Sp-ieiri. m Mlihoul iptati 

Cuf rmi Ssieirum Safiwiri 
TmHuwinrl US Ci»»»[Tt> 
Huy u : 1 1> M. fruvuiiiitiflndciiirn jus w trace 
h>i«iTn (hif lh if nuirsiil ilm Cur j I lilandi. 
Mitn t rifUllvrl 1 1 1" twitllriur unU pra:85 
br vat Nvti leum Hriou^gii lu mestur 

M«r"»»hiF uriilMi: ■■ I ■,. f ■.:• >ni|v ■' 

^^-iiH.rn^.iiinr.Mlliiir.lili i.-ihir *KK. 

JvrttKV a jkii 4f o Cnswuu! 

' i tti • l-H-l .Iri.l V.^.M-:.'- Illll! I n 

(i» IttynAit o< lime and mull find ynin 
,. .'. ,. cur.l i rih- r ■■■■..■ [wuhirtu aiilul 

pttl«fl»«n4 (*.|«..;i i.iin JmAi) FidM.ni. 

Ml*r "h* Slick Hti** ul SI Lluii i, ihn 
rjitgoa *■>! Kiadhl J U Hiimiiw Hn, Ihn 
BhCk On ul CMUdlrrVP A Omlkf, Thv 

^AilCl*#* nl -i*wn .l*J|»»tJ ■-»! rF»«y flflinoij 

fl, :*H onh/ rxlu*ri|iir t in' ^8K. in michim; 
CMblOuil-l, 

Mom Taiix ^* Casxtts) 
TV» flu* h« >' **< H' wmHImbiuI*. 
varitbtl «PK<13, vMi.il*: Rumanr «l 
gnupf Of IJXidbin IiH1<*k luiliiers «■ 
in i*rtj u- ■■' c.-in LfiiVlfJlCe^ iiw i iiur aibj-i, 
Mh'jlie :li^r^cli-H !«ni l.feil-i u i»irn-!ullMH«. 
Wr.JfjH fji(ch, FhhJMAUK hit :jiitii. 
priiMat Qi Sftf CH l|ihon«jc f1pyh*b« mh 
Curiah u:'?p«;h on 431, ireisian oWy), 
ird npiii feelisy. TakH you t3 vd 
Qt^Qna RYAand Amalaxji Raoc 'cs tn y 
«indjrdi. lCKind 1BK rtni^ni on ois 
iriiane 4SH d r I v en Lliicradri'iB 
«rtridj». 

bpeetfun Krefjrana an Mcrodriva 

A I tha aboce arc avjilabe an Microdriva 
Eiftrldjes it « pricj a' L4.i0 for t?ni 
cilridjc * Irm prict of iach srogra-r. n 
nfLiwri .i:ii.:h- E.G., a canrlcrji wl~h 
Tiinlewi' I ^ir- I Vi; -in rniir w;uld ha 
f/'J.Sa As i ncwus. Gavin Monlr/i 
l-fl«K,i7 L..:.i:lt-n-, rmlwdesfrai win eaih 
unridje, 

j.a.i'arjfe frcm 

WD 5a r r wa-i , 

Hlitor* St May. Jersey. C.I. 

Tai 0%'3KS1193 



frlUSlC 1 ". «**(«■#*, Fifty "C Jl*l* r , rwfnfl 
nnjiHr. Aty;rin m/nirwtisvi \j u»;" *0K 

Sw;uwn. SAE fc daaih, S«« M4S4»;. No 
1, tunriJlo*' Fiilmtb, Oikc^iIi*! Common. 
Sari i. 

«4 



Jij ii The 

CotimiC'Cloi'c &4 Cassciie 
Librarv 

1 All ilk,- bl.si ii.mh' Ka^ll SHIVitiT 

2 Dull (UK |Uitt! II Un , (Mil |NI 
..raMI.'. ilU.. ]1&|I IVW lull * ktijh. 

I, i^i ^1 ** t \ <m I lui .tf" Ii ii ^iiia. 

4. Mk-iiik-r-J^f il.H(ii: itvlUnii} 

i I; ml [^ -;jl in hi il 

V"*/ i J\'7lir «T /*'S.m I'tttl "rw .^ <■* 

tlft4tf\ M: 

Coeunwion M Cavxtlt 

IJhran 

l f ^ ]>trrirll Viav 

■Mi. ii -Hi m OVN I MM. 
TV I. Mit, 02.15! 27T6'J 



* UNLOCK YOUR 

AMhTRAD ■ 

Amskey 

KASV Tfl tnp utility pnwwn 
KtiiKHO i*r(t'c«,'Ttivrv and aluwi 
Irslinc,, Htufiine And ti Jfyinf <*t iiitr 

|™Hi il\ v rlnv. ■{■ 

VCU Ct tOOSE k»Llirf> if e«d im 
}inHCLiiiill ul" y »uf .t*.i-up ilipci. 

Orlr :A.*W itfl. p&p. :>L.»i 
pkswn; *dd i'l X<t iwiixj^:. 

Interlock Services Ltd, 

$7\\ New Civ^iKlish Sr. 

Loridor W1M 8|R 

Tel. OI-A09 8M 



U.S.A - C-W U«r UruvLi hiiuIiI 
IiIlc In 1'M'luiiij.i- -,il1"»ri mid: jdrin 
wl'h Fjiriipran Kimiin it* inrllvi 
■JiHlx. I'fcltr rJUIn. h«i wlltconddtr 
I ail-. Kc?piind lu: Me'ru-Arta 
Coninoda-rc Club, Box. M, 
Mfiiiuu, Mnnrvola, SMMi — 
t:.«*.A Orealhfnl2)71R-MSHl pa 



VtHJfl-riftfcr Sft-ruuattF hihv 

Frat nemle 'ii 10' 

Pqjw* ^ (0fi 1(| 3f> Tiif e Ti*», 

PrtMiHb I Txrit)! fion 00* [HI 

imk. Srro SAE Iv vour KwVI K* 

Wc-20 a«rnv;ini Hrc iTCi 

Z4Z Boniffm Ft^ld, M*pk»'l»' 

NO till Ijl-.J l!l 

J^.irr « ti/r iHJ^IWl? jtfE4ie *CrJ 



MICRODRIVE 
TRANSFER TAPE 



M !.!■■ M.UlHllTV of nMH WflWMVQM 
M It injlhrrcii eo Mki^diib^, crm i^hIii- 
-lint I'un nmrtaly iwdt SHrc: HI 1. 1, 

MM IH llll^HjcJ. 

' ll»i MP* W Mlla.ifiit rtlBiki dfju 
it Irinikr Uk HuiIl.Icm nri^-iirni 11 
Mil, 

* lihliHlfh jn irjeLgtni Utidur KtJtlfr 

■MIIIi'lI 

* Don M>T -<quire 11 adf kii>ql hdA 
arte. 

' Siini Aijlianniic. Tully auvmili,: 
n-Ui-wi*. luv^ ptan-ed [iniicd. 

Ii'™ it *orli: CaptA dntk* u> (ir 
M^. - i ttlrtti' uirif ih puih-tMriiii, ■ .^.fen . 
1T»L. nulK A fMHi" iny oi^]r tl:ui.c% IiiUk- 

ln-.iv kudu pari. Save it in MhuhIi vc, 
n»J riauH, ISSTAMT SLClIKSS 

tI17 WU IS JI.^T fj,OJ 

1 1 im|x 1 SlipQhcrjirfa.' - ,'l.jfj 

sriAIAI (JIFIH: Mmilw .)Mh ullbc 
Mrt'V'JUtIV-: kViiiiM.i Mmbur 

. M-' !■■.!. (»:i" mfj fi.ii jusj ihi (or cjti 
rurlriilf'i; of ,-.i;i. 



/X-t:* iBtMUll 1 l.,.|i.i 11 1 

~,t CnaddrrLon Dri>*, Cii«wii1ri, 

Bun. [jui, 11.9 IN]. 

Ttl: IKl-To* ST II 



HOME ACCCUhTS Fiji JwufrufJiU In&rddH 
Pr-jbatfy ** bcii hfliTie uM lor v-iv' 
ccmpuMf" Zorrttrehtftaiuj «w«tftpo ol bank 
■Hzouni, ciedi cj«i». UF. re. nbuit 

aoBwuty j^iccl. I» a" 1 uiMgi^U rre]«l 
irasnlkwf fa n>v F4*iX> J 1 ***- A»*ilafcl* lc 
CBV W <n VlC » f *.i0 * luu d*Mfc frorr : 
3SCJS SOFTWAfi:. FftEETOST. WMMl 
Hi 1, Br'tum TCdi Oftn 1.1 OJO-Sii E6S32. 

ijT7 



IMPROVE YOUR PROSPECTS 



with ski Is, that an plo f a rs ^arn - lavn 
theoasy wa • with rrwdamrtor™ flUvV 

cour&ef. Irori kits} ii "jtii 

MODERN ELECTFDNCS 

Train tor success inlhe ten* rvw 

COWPLTEn PROGPAMUliNG 

Tfip ^OTTwnd 'Or PlograrnfrurTj 1$ 

intTBni ng ronslantrv - flw'l mi<*oiitl 

For Yw Iwokiot wtH* lp*y lo 



: IDEAL 



iD--ALiCHfK>LS 

M5t Enoch Sq 

uli^iwG'U- 
r*:MiZ4ES2D0 



YOUFI CCMPUTER, LAARCH 1 0BB 1 4 1 



AMSTRAD SOFTWARE in ROM! 



UwiMAsAM - arrewHiil '*aurt re- 
n n. - .n-i,f *',stf-nrik' Mi-.i'.'.hi'Li in. 
EbiTer ■kMiili a ili*feiencr I '■ " ■• *><v 
rjj. "OS- iPRtW wr,i;h pi i ;|-: i! v 

imo iK *vs'nAi) r-.i. dj'i n : i '.mm i ■ 

ICiWlr, - if % t \M BV1 TiTEW V-ilJ I .111 Jul 
uk t%4 C'fic «<iii Yi>i alee gjot aft a 
tiunjt, a oe«- t*a™on social lor 
AiuOi'i 'jnq- jj Sideways RCM 
(itM'tifyirMCCrliiBnity. '« O<0mptL<, inn 

ijrlhromnq Wuni Ptoroaajorl. 
HAN KM ascend tost HAM snmc K 
klsiuu ip.. BASir .1 in VU:l'ri> Code 
.^i 14(6 *io B££t- O-, v«p ii'» 
iswiA due: I f inn i 'is Editttr ind 
»,r>i> ■.!>> mv kin lh» Frlr-nr In rflit 

BASH [fu^'ars 

PMXAM M ESSEVnAL BbIiwBP* lor 

r**)Meia AWIStBAPufjii 




MAXAM 



MAAA*I, IHcuuftnj A_Mi>l r '. COI* l<* 

On Ci-mrim Kaiiiilirdl 1 1 3.SO On 

3iat (KM triune! . [ ?(190 P*.-ci. 

ndute pii-:i-ii.ii:liiiu. Fui runribaqt. 

ui'nrJHWl 

Oidi* Hsibik til Ht3 MB3 12am 



TecrBucalDatf 

■£u»cf fist , imw»i«5'i'i» ifMfnify. 
* Condi ii^nnP Acn:n*il«Ly ' ^jui Eit^tfh 
hio irvHigoi * nil ExBics-ibwv. 
evihiaiitn Vlwiiili't bml .itiie i> aiaes. 
'Unticii^n .rcmic Olft. BVTR. 
WORD. TEXT. HMEU. II T * tit t 
PUI, MMII, WVt. KIA.JUL l**t>. 
Corrftwds incMr LIST, VOL St, 
L15TP. ntLl. PAGE PLEN. width. 

" Mi i Li- [ • in.Br. Scrtier [dtar irnjltdti 
mow capy and Hfi'ir bto()«, riot, 
iwruh ii'ri i splice, erint .■Hl-'|iarl it 
(0*1, Laid.'Sjvp i '..-ja I i' l'«l 
r.'i .i ■ m i'ri utjiwun iji-ip nu^iim 
dllplJV M«fifl(y Edit tci"iH.irilv 
tjUMfcin j M . A«( March n RAM. Jfk 
to AMSOOS. 



Cheques /Postal Orders to: 
Amor Limited PO Bsx 513, London SE25 EJL. 
6K Technical Enquires: 01-852 Z174 



/**fe/ 



AMSTRAD CPC 464 

UTILITY PROGRAMS FROM PRIDE 

AlftOVI tho lir-J will |l'» b*M tdftwjl* OHri iij ma'* IvllliMl ftK* fc»llt-l v.it.i' 

KM imriDv Bum mrwr iftnaai Si-Ofl'Jitic .iu** W» j'sj ul ! m - '»»s .Vvutv *"J 

|rbfn||li mgl rwri-r luervt^*- !*■> ^f^ji'v "> i^nCurHj. 

SVCLONE CoflP OPdtoi cwrtil f OUI pf otwn* In toad In u# lO lour limol 

Iflitftf. 

'wluin .n-.'khl» 

* CorafTwr.di av»li^^■W^ hom BeK 

•■ Cpb if I "J' liiKi»>^ ip<*0l, lOOd ifl 4000 u.iuiJ 

* Copios 3ll l«l«dl«1|«rlPt, 

* rirjmpH-hHMiMVK fBSdir 'fj(dfjf. 

* lo»l mid 'Isi praiecicrJ haam iyii^nhii. 

1 1-1 viui "Welcorna" lain;. Cimitla ':6.35 it: P&P 

NFW ■'- NEW"-' SEIW- ••* MEW **» HeW" NEW **" WM ■•« NEW 

T^AhSMAt "rainier ru-ui piafliamL snn ihi Amtiita One Svtun 

'tillTJS in:ludt: 

* Fniikil^ lijui&i* JHI piOflimj 

* Adc frSocaitr 11 oecoisn'f 
«■ Aukl 41I- nur. dalo rr^OlfC. 

* C'filC 04 "Onimil MDy -irru 

n Curipretensva l««ft< lAftfsi, 
Ciimt [7 95 in: PftP 

ZsDIS A tomctehensivr mjchinr c»J» rikor Hid (Stanflrrljler 

t r tet|.HfM; irvSlllT*- 

ft Corrtmujl minu wspbv 

* the A imnt r.serl'or 
A Ht( illtr m ipire twn. 

* Hujl sotad Pmjr codcsiririji iejrcK 
If Hr-j l'.i .■; ' -I' "i 1 mik.[. 

k-kl'UL'lOfli indinln-! lu il.ini.iei'r'nlt f\QHb 
ClMettB'FTi Ht irn: r'ftH. 

PRINTEH PAC 1 * pihlm nnhinc»m»rH (HGV*<T Tor tflB DMP BnrJ EpBgll 
■»mn*libl« print**-* 
Ftilwet ircli.irh-:- 

* Scatn Jurtim 11 .1 I "milTb 

ft Twuu its* 0" tlunigi 1lm ttsan :«muMI( fxuli'u. 
ft T#iT rju-rtp h Bll rrvodri. 
ft TnuT ri-w TypHi iiv'M* lui iJic QMH. 
ft AtjHri-wlr;sl ti>J?S K J]f.''lc 
Cl-.-.rllir !'. 9t lpe PPJ,r 

SPECIAL OFFER w«nr. es^s 

HiiviiKH-t tlwoari til» and (hm a uihiib (tuiiwiini a rral nmr ilurid Maan 
Ckch FHEII inciirtruj .|-l (*«P wPltir HBCkB 1*41 L 
EuopB - odd C I 00 pc titlo. POll of VrtBK - Bdd It W p«r IIIIt. 
Jfc-.^ PfltEJE UTILtTIES (IfCl 



'S^J'i 



7 CM*. rt>*t n.nflH"ft. <;n*LT(in F Linun, ucju lu+ ;yi 




STOP- REVEAL 



>. .iK;-i-ai9?lli. 'f'.i IK'irK h:H'i U'.lll 

I. H.|...|l ■ .-, I. I . k. Ill 

1 .'jIl'^ ■--■■ ■ u-.i i II |i:*ja*n*, PAAlfC, 
VAC I- fJE f<Ull HHl n»«il 
HEAOER^SS HU-S ^..tMih(dO< Ail. 

2 BEVEilv flu; 'ncsliti: Hjii: li Mjitrpio 
Cuk imi'.i'-'""' ii-.-J In «iyrj "■ 
jrjvtnlirr ip^n t«l. 

3 l.lSfS Ar;[-j*l Hlcnn«(Mr «n imif 
v.ik'-i 

Hwk tm ti- STOP, Lip, vouiy, 
STliOT riD4lSptilrin pidjVtvbI four 
kuiLrs lAnd chkIt ft Mfciocivr 
tfirnp*1rli-c.- 

nifiBttw s. nt'i'iAS'i'WFt fR *n mm 
hvv 5l.h 5iri'.- ti H2M, ^ie, plu* Ifm 
, .- AsV»)ttid IIA!:£R RIAD6K wai 
Arit-nn. plus Barje> of EECflETS Of t HF 
TR#0E tyvtAtmt prrye'sswn.il imriiusfc 
l«rf Irj lid» |rni».ricrr;i'i-i ell 

yets CAwar att a sMJii 

WKtffffit VAHM .' I - 
ILvin ST0PS-*1IVI-A.IS |i' j^fiB»fttikh 
ae > f]€!MJ ih,' *.K itiPiL 

PiJ*<i i', Hb m-h 

SEusoix} oil' ■ .' rJ"'-i ,..'i.t\s*fdf7^ 

ICERfi. 1-aHKJH STREET 

ItNLi'S L*MN, 't/0 IB* *S* 



SiUPLKIOR SPECTRUM 
TAPE COPIER 



il.. ^l v,- iHT *,f\ j. rlnOMI.^ tif.| tl 
riirvir^L- n( nij«iri)i c'-il J lull .Vik 
Hrsile»l"i^ fi L f.<ii". 

* (.\iptA iTll ifMll inicidrBV ill ir um 
I-m I ij- .iileinji,..!) 

* t n|BLji projrtiM Eirai I id w.llttiyitr 

liair. I (.mi \ ►W? 

- L«pki iHWHrMt ft«<-Dpl0i fun -UK 

IMf ulli.'r .'I'pitr inn) 

*[ii;itoAII lj';*i, tjnit.f <-ii-. Sj«n 
\i i i 1 . - 1 1.-. i Ifi L^-. 

' (i.iauik'iJ uui! k' Jn' 

■ I ,.,.,-■,- ■",-. r .,-,|-.- «rrn ;j.:«i 

'i'iJi'i ci >Xi.'\* iu|i, 



Z>-CLAlMS1Lr.rjri>rpl ycf 
1* Chaftdrrttn r>n(, Uftt->-«ni. 

IhiT). l-ifiri. rJL»«Vl. 

Id: MI-"** 5Jl2 



SPECIAL AGENT 

DE-LUXE SPECTRUM 
COPIER 

A mUli-|Hjrpai» ^at ek.tr«int;l/ 
easy to use Tape copier, tk'il 
fCi (tie erpeiienciBO or ahsoiui' 
beginner. 

•"■5 STAR PATINQS •**• 

1. Copies nult part p'ooFams 
at in on* loading. 

2. CripiM 8asic f M/Codu and 
even thn Hrnrirrlnss p'ogiiams 
upto 51 K, 

a. <Cinrm-t Lti h»)lnJ iy v^eifj 
namcis of fa tec Headers. (Othsr 
copters 'A'oiiln r?;jsh''. 

4. Can remove AulosUrt tron 
Bisiir. 

5. Yoy tan determine PMS*tj 
btuviiuit s^ciiurvs il desiffrl 

Once yotiVs nsrrMfn(?n.;rri iHe 
Hutwr DF-IUXF dtk smnrih 
copier, yau'l never warn to use 
any r'thnr. 

£5.9E 

iOfftervs SP£?(M AGEMTi 

K£RH. 2*-2S Hiyh Slrvvt 
Kiiiy's LflHIi ttttffuf*., PC30 1BP 



ATUOS .» * mMntJir'e.'CMti n,i ■ - . . > - . ■ . - 

iiriii i J^^.ip.m.-i- il :t-i.'i luiiriir.. !' -.I-- «t 'i I' 
I'.i.ll r5 5S- W BfpilWt*Stl flrJJKt LorKi.J'i 
SFBlOX. ^7 

COMMODOnC H l.>»g--i,<ii <mic<'«ca Mjtic 
rBliBtllH bjilup c<i|>a 'ti Uihfi ojdlT'j, 
irt,i::liin> cole clc . loir <LiU»pfb> Id iinrv 
hi-tjc3£se1l< rocv^." $|:<n:'.i >nrln;du[l<Lir 

afl>r r795 Vlcliun* Vi1i>»fihi rv tVivr 

Hd*WDad.CL10Zm. 5W 

Sd^PfJllE pTWowy (YkiJ' liarp bilftit « 

vim plrtv Vk ?o ' ISC, CHipfJ f l 50 Jnhn 
f'nil!.^. ?4 W-crniv ClMUk OHlun Giov*. 

NoLHr'ni'Lin! hffll 



ATARI ^OO/600/eOO/XL 



(riii'iilgr Bickup 5>it*jri 
3j:<^jH "ft!Cr.»likJfjc (Dljpo ,i i. .i 
Jft? 'ILHJ w'r. -IftK H'*. Do Ion v*a£n»l 
p*i <|i>ii1 «i<rfn »wn ok ait|Pif9» 

C<1iiJih - .- ii>rf tiff 115 00 

da Mixu i an 00 

Srmir m t liHM Dowel , 11700 

da pui« L > / Do 
XL C>rii>4()« (VffCkup 

.'■.>■> EKJ01 

: l ■ ■ I', i ii ■ .- :jim 

ill.-- I .i|-ii. ,iit.i 
Duptcula iihnaM any ailtBte < r mniusli^ 
iicur UASIT (xogi^m. 46K um 

l-Il 4.mnluil 

Tapf FJu|l (.il I" .£6 00 

Fjut LaaJai 
3kKc? :j(v- ie.hhx| limn cl .i(^-»l a I fil 

*-.^f' ii..(L- nuBIBJ^ria IspHC riT up IA 
FiWl l[**rr ,, It ..... m , fREW 

103 KL Manorr UpfiFaflo 

I. ,-..ii.. .- - •■-..; In I" -IK "umlllV kil 

■.'. if' ' I I I'll- : iKUt? 

V-t'irtn> LtFMdiad* ,, ,.£7ZA)tl 

ft a w aJ HM 

I niwn ,« jj nL-jin blflyhp iurvi:<* «lso 

,iv. i, rtlll) Sr-il 1ot<iffltfy. 

Si.ti ■ 1 1 jj. : !-Ar cf ^j«f>f* ildwJ* on 
urn .'ill 13 il'.f MK5.+ and r>nv cii>*jcH. 
M 1 1 :i ... n -..'nmvw ul (j<Jv UllilMaarc- 
lur 4 JO ■ WO --JCL 3MXL un!*» fillienAW 

:.|«^:1»l-i|. 

S r»rr,ll 
17 Coai CPeie ft>,>d. y. ,i» v 
l<ulBrU(K0ugh PET 3WJ ,, 



Spectrum Rep turn 

f]Ci.9S jncluiLW of llhtrij - . fwii-1"i tiJi.ii 
i.-U-, Z\S] br £1 1. Fn>t i* ial«l* «n-m-, 
iAv nf *ir H lirsF In' qytiJiliril rijtin- 
itn, Si-ndcnnnilrrcnly Kk 

HSUtJi*! 1 ! I r.l.>KrtVLrji 

2 TbrOir rwid L U ar Km. t*i*--t.*.. Ijncji. 

TW IBE.TVI f"; W.Ti.*..rKHil , l7 




a .. .. . .. -. 

. ■ - ii 

1 i ,^£j\ !'k-LiLi»*-.«.'llft— k-k«i'0'jn0i4:f>--] *' 

I . . . . . . I- ■ . ■ I. . . I . 

*l mmi»iiwi r*^nw*»*.^p*. *'~ ■-.-.- 

* C ma ' J< wi irin^nit- M»*oFi0wf- 

■ - r _ ■ ■' .-tl'l'l. 

■ ^V-i^wj.:fl"*4Ai tkrV I IJV.1U. ^iw^ifrrt^iriiWn 
Sin mil 

* a»lnU!rrnjr*jrT-n»jMif«'»ja»"l1Kl ■" ' ' 

■ ... 

* lwl-*^*3lEIHril-«U!l» '|PS1«I - - 

4 CftrotMBmot -j«ni'«»neiar - rr'^'PMmiur*" 1 

— wiin-.r ipiblivn , 

Sj^l^^ll. : ,i.*w <>'l»rjikT 

A** i l*T»lc Hr*™fci=£WlM 

cmo»kitiw4 "« 4 uu*rn 

... i-s>- »-p.|.-. -.■ p.li, ..<■ i|i..^-ji-r ■ *> I '. ■ 

-irffciwy: ■» iv-.'* i-i t**ijii 

vikCwmnicnrCOt ccwitutoirraMMCiaiiro 

|IfI UtU-iMJf| «jn 



142 YOUR COM PUT ; R. M A 1 C H 1 £8b 



SINCLAIR GL 

Odv £37999 

QL COLOUR MONITOR 

Only £25595 

COMMODORE SX-G4 

PORTABLE 

(Disk Driva & Col. Monitor 

Buit in) only £795,35 

PHILIPS 12 Green Monitor 

[Composite video & Sound) 

MUM 

SINCLAIR FLAT SCREEN TV 

£99,95 

All prices incruJe VAT & Fast 

F _ ee Delivery (UK <nly> 

Please send cheques/PC's 

to: COMPUTF.Fl PLUS 

45 Br icge Street, Mawvcflstie. 

Staffs ET5 1 RT. 

Tol. 0781 622333 



AM SCO FY II 

f"*.'^ HtefratrKl ■r.'rshjn ij' ihE tHrt MUHH 

\M5C0rV aaih\JH i^pirr. Ptctf -rpi^s .- II 
ti ocki i r off.- |j. 1 1 v>i J l . i 1 1 1 1 FlM I -.-• .. 

Toyiil <uv»,' ^Liij'.'il- 'J 'miii'j i ! 1M ivj'uL'lt 'I 
rttjtamd Mil Ti.rhi" mrta wil rvi-v :ill i :: 

'-,: ■. Iii'"i i- ■ ■ ■ nr.-i i 'mm r,i ■ m 

i\*T. inplinl-il >:■ I ml h*ttl*f r**dtr — -*l 
(Mi lH m luHf .r^ljs v.', 

UllKA'fcUIJQM'UlirJGI 

H*Or f*. HMvuit rl w J. 

Mlqfi Dimur; SurderlaiLJ. 

Tel ifl/HJi:-^^^ 

'infr^j^ |tl«»ie Ldd £1 54 
lOwnfM «f Ehc a iqmnl ftM'liCOfr ' 
— SEld "I. ThP "l«| ■ iJI (|M 1 1> I i-j -. 1 I Jail 

n,l w#TI iiut AMSCU^V || u -n Lhr B^ 
:,nJ-p ui il vrnd ll jv rr urn.l. 



RMSTRflD 

TRPE COPIER 



CHOKE [F JjUE 5PEEB5 

PPOiUCES UhflfiOTtCTE-S CCIEE 

0' ULL PIOGFHHS TESTES 

ohl_v e ■? . s o 



DiSKount PRICES - 

5'.V SL-.'DUDisl-eiiPi I" h(: 

3V Sb.'SOOiatBHei r'4 h( 

2GDD SidjcI: '1 1 'ls3 !i"l 

Lis Ing Paper nr x9"l CIB-Ot 

CASSETTES; C1S Mp 
C2l>6fli C3D703 
Mlrss Lchelk I ndUt d Vt l 

1 Year Guarantee 
■ ;i&p free; SMtafy ■ iUiw 
' fi.ii:ipi di;counv> ..iv.ii' i:ili; 
1 LVe e •ipplv- tchoL'lu H >- . Jl» ■■ : ■ ». 

rJW(pi*tifrfT'i ro^ 

( H t. Lm n(julai Sorvicos 

14 4 Sutilif Ft Avenue. Grimsby 

Gil. lun-bi. ON J] lAh. _,,.,, 



ROY.M.TE5 ^a)d an pnginal prog»a rs 
accepted farciaEroLrtion.E^ejyth in g cor si- 
dared.G«nuincDPlcr,PnorpO&l073[jCi3L-i' 
send to: uro^un, "frrcpMt" IMrcScrli.-'i.P 
SJ0 3BR mi:-- 



ORIC 



ADVANCED USER GUIDE 

f-tr the U r if 1 ■' A 1 1 ' i*:,. I ■ ■ -. In Nik 
1 1 1 .■(.■■.- .=1 

rurnp.'lu I usi-ipr nn ;if Mm <1|lf>r.11inn 
rid III';" r-nliifi itnr* JilllS, A i^iiiii.I- I' 

liO.Vl : la***w-i >*y *wJ nic.-.ji: diagram, 

'It. .m' i'i.'rf 'nui-r taOtalMpd r?r fry m,Ti'f 4 r 
fHJjfi iH.r pAo! (ram: 

ALtUbK PUBLISHING LTD., 

POBQX 148, 

CAMUROGE CS1 2EO 



;SB* .nuJu-K-fPiJc tallfl r*W*KS8 "Vr 
8 txgininjfa SAt ■ Nt;K li .wjun-'i , 4Hi.miii 
^'cSjl'mI Evrnmul.h-, Berwick. TDK b.Vp. 



DUST COVERS FOR 

AMSTRAD 

CPC4B4E6.95 

* Mjl:hjn.0 pfooFrd r.vFoi, trea.td ivih 

anii iiDtit in^i-iitor 

■ PijB^i ii'i.;ii!ii' Willi AHSTRAO CPC464 

i hi k^vtwUrd. 

fc SliilH: ii'iL|' J in Irti^l iiMir. Ijlijiil ni 

i: <ll. I 

COvERSFOFQTFIER 
COMPUTERS 

tiUU, UKfltiUK, LJMMUUU'Hb ir.oage. 
pipe-i i*i red pi trow. TOLD ST^fl, 
SAAYO. SOJIV, ;nd lOSHlUA in back 
()tped in gray L"3.i0 SPECTRUM PLUS 
and DL ir tilafK LZ.OQ f*cfi /vtth laTf on 
hetfToa'd. 

MATCKiNG COVERS 
FOR PRIMTER5 
A^OTRAD CWn . CA'dflr. ^WIDHJA. 
COMMCDOHE MP! BO I . EPSON 
FXBC'' , a<Sil VAN WES NAN MTBO. 
PArdTHER 0XSS9. TAXAN KPB10. 
BRCTHEP IdRB, All jIl3.65. JU<1'6100 
«C*.50. 

^f .'ir .Jjr^. ,l.iixn„' r .','>;[ eft^-j (JCJJ.'.lf; ■ 

PFJD Cernp liter Du»l Cquqt* 

1l** Mni-*si jlui^niii?. 

^ngUingitin WNS 9RP. 

Ttl.Q;S7 4229IB 



liUAHI>Kl^>M Sp'i.-rln.r i^X^l HK DiugOT 
32. 5L|TKrb!y 'ih niiilii, g n-n_- ud Isuynpffi 
n'r gi.Kt and akll ffJS ;<n;f-, W, Lovsll, ffl 
MiinirTPrflCiftfnftiil Di. .m.i -.Iij BcUe, LUG 
3MN. 55! 



ATARI 

401'DOD'ntlDfHODXl 
T.ifl! Ill [>I>V Hill V 

Ti.inr.li-' siiti^lr ANiJ in il'i i.(,iyu 
"IuxjI ' lipes li> m>k u»d (liui ijri Horn 

fl ill , 111 ll. .Mih ■ 'ml i| 1 1 ;■ I .■ hi !•■ i > 
flllMh >f I ,1-1 ll.v i| I! I.M 111 T i.. ■! : i1,h q. ■ ■_ 

f 1f rih_.rr. 

Tapi (^oniM 

Par. 'y rfanlirM^^iVlQb anr niN cki ^P i^jia. 
M.T, BA^iC.i>vd«ri npr-nianflarlfarrnjll 
1ari*FL. CpiCim to !4flve -fioaiflF, st fiMlnr 
hsiri ratfSp;, ffi,3S inr 
Clifques^PO lo C. Ciiiiln-P^. l/n 
Bradwell Cnwn m F>nil'v.ini. MJi«i. 
Keym-fi. Buckii NKUBBO 

ltd 



ASTROLOGY 

for beginners 
only £11. 50 

A iitirte-i fatk ^oirpisiiig j iimjle 
progrdim lo cilctibte t ^QKiKsne, an 

intnii'Lctorv boo ■ el 0.2 ssi'-liiiclrg 
fiifMjiLliii^ I Ii4. uv U ndfiifin d dfvc llCffd>~ 
sf:f>|>s!. 

No previous knowledge 

required 
■1BK. Specie™, JfJCt-isdrod 4SK 

Ore, D ificn, Tin-cyCcsi-ii, Tards 

TREBD, ■dun'rnD4iiTDC*. l t-ET, PUan. 

Ani3triK). S'urp rMxlKA-TF^Frjo^ Cyl«n« 

fiund*, Vid^rft 1 ■■• i-i i -.'SyMflii SO^PMCSC 

ivany r]d , e pntjjfjns lor 

oJVCf'vfiCdW ■09 , 'y»qf/tvs 

a.!si> ofrjr mcr-as 

L'L'z r.dugii«nii hw Ji|« r>unv n 

Sj-m :■<■ I 'i^idi.l.idir^ ^Jtmr^a^z ^prlcn|^Kj^i4 

pCforSpBsiliuT. Vtaafl rjociTunlJli'L'l 
C*Ui vAI w Jor jwld iOji (K.:*do UK] 
ur iat^u sob of itio (dltu -csl il((.rj| u* li> : 

ASTROCALC (Dept YC) 

67 Pease rod Road 

Horn el Hempstead. 

Herts HPS SER 

Tel: 0442 51S09 t3: 



MUI TI=LV vriv> •hfiOiiHI ,l'"(ti MOW Miir 

'.KC HHUkllHTHUll ffclHI-Pflt^fUH floSO- 

Cl^Htiy tl^HJintH ItHl, dH|i4h) UlCKHU . At 

way! iinii ttnij ™ lui. f<«* fhia>ii 

T-NlKrBm-ld-i I* ASSOTATirtN. f|(»rn*4 c 
In- 1 Sun: V.-,-,:.iii , m Ji'ii ',V 

4TS 



I ^1 lAd^d ) Mtfi 'i1« i :.i If S) ii >.m SF>ort 7S« ffill i 
- .'"Nil- 4'di:'.ir;i:rii1,! RACnls. Allfunc- 
lu.:f- -.' i|j|nn1r1 *h i'n-111. lirni inlirirc- 

i it: ;.■•.-.■ •■:! :-:. Mi- i i Wi-njiv : . ■. 
I 'iirnriil. W'Hl ln>ntwirri a MfiBR ' S3* 



POWERFUL UTILITIES 



M1IIM FMFUMBktltyTT 

■.IIJWslll,- -.ii i-,- «^i Mil'Lidf- 

I r«F#rW«j ■-■■V\r-/i,'tri.'-i >„Tr r-\P>-TT'f 

■ i * ^-rarc-f i/f IFvft tfnft ?■«!!.( 

"ri-l ■■ h^-T '-■■' AJ\ -■1.1,1 rj^n ,j 

| h^jwIfP rmmiwr .■ , I rH-p*- a C-tT bMilf 

v -. ■ /.iiin.i)- i|\ii: m wr IIB 

' TiirMfclii ■^r-PnThdin^fP 

OhlT>tf>» 

lAJW *r rM>". gCll[y #K fc'rrl,' 



TfVi ccppms 

L'-i'-l*' rrvThinr- ctdr piUJMil I ■ 
.Htr* :jt". .UMly bA L -ijr r COtftrt wl L f 

T.- ; ir7 ~» irnr-^^n-J tjiifrw.-riN 

" — - 1 --■" -■ i — *.»i.i'.i ri-fl 

HMMiAiTrr > . m. Ellt 

thMnit 7 J** 



TAFtTODIJ-CVriUTIES 

■■C 

rt wiry iMful in- nr^ h" hPlii mtr 

'fp-v iiuLDu'^ :*of aruriftmi o-e.g 

yow own^iui DMLT t» » $ 

ATAH 

A l;ijj^i pjipM* ,ii^him "l i^l ..■ i w:, 

-.rijl* \\.f\fr \y.?\\ L l ^lly^.»1^ lu Lie? 

v h irtft1 n^.-n ^iv rn'.uiVi t\tt>il tr 

•,'W '*■.'■-'. :■" J4I ffifrdtH 

fJMi.v i. g g% 



COM MOD ORE 64 



noic srtecToit y».e 

Ailm . rully Jftwirtul. -.. i n- .1 1| ■■ ■ I m»> J 

fj«ri» l iLrWr'lUj'iLU> , " l> " •■•**-■ Tmapir' d.>n.i.-:*miiii««tui 
'ruliiijAKT^HhsIf 9n tirsrCvpv'.ui - I - ■■'-''■■' 

■ II rf -.- l- f L*1 r^rt Vt^ il'lUP^^ uPrJlWik-ir'i'r 1 -■^r^^lll^-! I. 

wijiwiri qukuiie ->it m-<i fjrrti iiv- 'i' I k«'x 

.iVI ' M* Ctfltt -i"Jr. l*P*Ohr* i'lij-iv in- n v Tr«» 

MrfEfUl 1 '.■ ■■■'Jrl- I .' vl'i, ll i.i ii.i|.it.i.i;i,i- ■-- ■ i' ' ■ 

■ ■ji. i-ii.iijp^i *"< ^hi*i«ii.i. *+t* Ptj..™^, bh.i^iBiyii. bim N#nit#r. 
Mtni Mik*r, i-m»i. rfaflrtt. IMnaiFr, h'lHPM'. 9M Iw T»n» 
■m Tltfy Ilyii ni,ii .1 ".1 I >rij flHH 'i-i-' I -t ' I -r--- ' ■ Si| 1*^.1 brt dlri 

Mill J I -.1 1 

CWLTtIT,fi 



irriLircwHiiu.frrMr: 



Nil l**4 Vwwtp 

1 i-i ' mi* U7vkiM"n viiwviJ , 't- 

Pllfllf<MI««'.M i-.M' ■- 
nml inp^li-plf «*r<P i IJfpil i 1 ' l< 

:&t frtpi' r«w » PWdM Pi""*" 
i- 1 I-i I .I- v '-■ I IRM ■■■ !■" ■'." 
PV*H»F1 -a.flAJtf |PJ1 I i.n Ht* 
p*nl*4ttlv • r f«i.h mi - Idmpd* I' ■ ,t>r 
a* iiinjmfliM 1+111 rj j iPw^ 

■ ..' r r 1 ..I r-- heOC " "■»■ 

Urn i-iHihi finl^ili-iinl 
dm JUC ki«i 



urji 1 ■ v *-. 



^^^-i^^^^^^^^-^^^^^^H 

IIOCKIT 

FrJuu.w*J|l».| 1 i 

r\artwvd -,•.•-. r j h r i i- ■ -ii -. -■ i 
rr fin-it.pi-rin ii".'. .■■•• ■- "ilmd 
j.. i , -. . . rv .-'.i ,■ kumci ivftf 

«|| JltrA"|iiJ J V<r.irirj ipirtil npyi 
..?i.ii-, D<»i mi ..fipn ;l ■ ■ !!»■; 
.|l MAt-: . < IKS n* *Jl H U1>a IT) 

'i' m * ipud w>n p nr 

i;fpJ )y.; 1 ■ :- r«d0#d fn i w p mn 

Himly /, 11 LJJ 'j '.nILul \t I 
.|j iili-u-r . rt-i-. ■ Vivr ■ I |JH!*I|W 
Of*L¥ tT.tl 



QUKKDIIC 

nminirlninniilfilr 

wn cvtmrAiTtir 
Jprct -i .■ ,-i " A l I'"- 1 'I-- it-' 'i'i' P*flW 
iii^rj p I ir'h ninf nrr^p'*^ -il 4 tAUH *n 
inir'rrt ^pdr-ilifp^liKirllyi .il.-v >im:ii 

tanma* • nww #i4 r*i( iwning an 

/am iwp Plitl ^<i in l-lp- J Mr pel i.i jrl 

I im./.I'ii |>JI ,- J^p. »i'-"IH*i^ 1PIL 

JfX \m | : |-.- il.li'V, pi M-'ri .Vr*.- |P I1H.1 PJLN 

1.1 I P- .-..li.-IT- f. HUH '" -i ll- .P.-' 



BillCO 

Wt |iy«Fjm*r Pi-il Itrt -■ Ihi-ftm 



1 



'i-i- ij.i 



V*fj »*u te »if « fwcflf*™ 
mlnf JnewMgi nft^X 
.-"i .' 1 ■■! .< r I .-1 1lr\ ilr^<i n-rt 

':r' . .1' i- 1 .ii j « |n.Ji^|-H P1l-» 
Ir.-ift* HIM iPMlt Ml" I PHI 1.1" 
Itji inr"l rf-il IMP -Hi:; |r'-.i'|- 
PaprkMit v I auKIOlIC K'17 
lor Mdiif^ voop u Ai 1 :r 1 

OWL* If .H 



ftlGMO-UTH 
lr-.- ct^parb new speech 

i)fnl|>p«)li n»i,ynllli (w (IP (* 

l5mi ' ip"* ' *i 'i b*j : 1 '■' 
nyii Vmy *My W M« (.an x 
ftd r-HXS .rd-s yflur D.i(i( pc- 

uiii'n Wcnh -in- wmffd 11* 

nrv. fin c 1 njiivi .>■ ipftwsrey 
Mimid ti*-.«| : ,.p yn^uUfy i; 
undlinltsd CrviT lun pv<; 

li>- piJfHIWN 
unLi v p pi 



JM SCC'TCif DISC! 

I '■, l-'Ip- -j-j.!!-"- :■■! !'i ■■ ■■! !■ ■ 



fmyjyif^ 



in p, -■. nwiwAfv im HtrnMri In 
dm*t**t > "1 *\r,;r r,ri t4$i\y jrt-y*-- 

, - v -..*. . . .-■ I_^ U . 

WhWW f l >M^'|J^f ■■■■! hWSrWRWf* 
lui ■- p .\ "-"Ii *i .,h I'" 1 

■■(F-ih- aiii^*»i' l^»-^^ j ibMnd r»r^ 

ntdMnri^f ,->rrtr* Wrk.^1^ ■ 1 
" ;a *■ |, -" , * **Y< f5 *l 

mcrmw 

if «i'h "|r.|«||.l v IT" »h IP* ft* 
Ll Mv- i\ iip> J.ilJ^r ■< Mir iviliiufll 

■«>ijrfinuh; nto immw. 

wily 111.n1 

W^P.IP'P'VtftrOi 



ClIIIUHMry .'PI'*' ■*■!■. ir .-i^l.r 1^ 

>>4* Kk^lA * n l #. w*^-rii .■.*«* ^tM 
tl^plpi+l-l* JirJT^T'N*lil* T | f^»* 

Mfll«<P 



rpwf»i|l^ii^.--1rt^ f :j.^ 
'.■wHr.rMPMlPii.^^. 

| Hfllll^ ». * IM I-* >^« 



r.nyptrFR tS-sstfr^ farming 

INH.i StKEAWoltarjow JCW0UAL I VU:ij<;A liONAI ■ -V.'. II -. - ., : . •■ .1- - 
|pahB.Sped:mdTri.MC EWron&CSMW.<i*ii.ri SPEC'ALDi-1-EHS O' UiaVC ZC 

Eta* FMW rarao cwofj VIlKO CASSETTES d»ld 0ODK5 on SASC. AsMrrtrH* 
Lifi-uage arc! Advanced s '09, ra r nn i n j . ttflirfaf Witti rnOMCHUHS to Txth, 
I ilf), I n< r> r\ P.ifvtaf. 
s.-iu: ^:< n SAp Ii-., 1 ii| 1 
it* 'Jhjiu LirL-e-i A'.'fi .. 

ivu'oomt. *** 



1.1 



)r-MA[IOI\ I Mi'Km 

till If |5. f'" fl! I. 1 '.!.""-. 



EM? tfB. ttf-wi! cd'OUriM 



MHirilMil. ;enaj)puprn urrignrlvn*4cttid Ofjc ««* 
ObrhiHordOr* 64 6d« E*tiwial SI GjmM C»^ 
iipirmiiiii at oyliH« p'relBrtitOiil «hi:i 
i.lncilv jtllrj'c:! to-3 Stud ygtr trc-^rjm f3r 
r-ivrr.iirTjli-iPi Kfllpjijil Srirdi.!*'* fl HO 1 'ti ~-\ 

liJna Sujd. Eijby Lunsiihird; SSB 8Xl 



MICRO CENTriE 

■ PtEOI I1HI1. IV1WM, 

woutt iTtm.p"«« 

P*l r^U^4TL4l 



OWTI.HT1 



Micno CENrrtc 

IFMI 

fOTTEIt 

T.I SII *ll DH 



SPECmUM K0PVKAT 

Sirnplv I he bttt Ctipyinj im l£-'4Sk 
Spictrmn p-rooi-m >i tt miv ■- 

L0A,[>ine i jAV-iflQ your OW« 
programs. Evun unsto P81 bi-p jrpgrami 
cir ftcnv o* etSkfC'iip pntp 1 ntin 
up*, Only 14.05, 

IT CAN EVENC0PV fTSELF 

u 1 vv 

MICRODRIVE KOPYHAT 

Trwitpffir vamr cm«it"Pi htftt «ifTriiPii-« 
onto tFin JX Mtcrotflw* BE LOCATES 
pmgrttrr-i, Etopi A postal ■ sraa-im* 
tS&EUTIAl. for M;0 Mmfftr. Only 
£4 »5, 

U c-i 1 1 with FFEE Mea-iier rt««Dt' 
□ Bipaltpiaaby flelum a' P011. 

MEDSOFT 

PO Ek» 84, Bssingatoks, 

Hantt 

Idl.'U' 



UNDBBW-JLK to Mkradriw*. tatdlCI 
nowd -o E»i<( sBfl LA« J & 0K0 0*^3 
N«n"Wriy (df iMtinj. n sti "t dclivvnv ^1 
rsccipt, S«p 



COVBiNtD iniraduatory f-rogrdmrn n( 

teur^BBtd ri-jpni ii>riill".o;idllvinlst«ut(<j) 
Sno-.viJaf.ia. Slut) -(ilpCofnp*jt»r Wolidwi, 
Bi.:.niy l-Ofl L.iiiT.^.-.ij,L:'.V',T'i<ddU.?5 3tH. 

Ted:028687O4O&. 495 



MAGIC MESSAGE 



Put VQ'Jfl nsme in tta HALL OF 

FA^^£, so rjw HERO of tho gudrxs. 
Fine; lhn h'diiftn (ii.! o : wnfd* in 
Atdv«fitjr# pj»Ti#t. All :his it 
possible With MAGIC MESSAGE 
wfiith <«is you look. ,11 ind d;han{-e 
intHBageTt in mid :Fiirin-c«i« gdirntKi. 
Simnle Inad IVAGC MESSAGE, 
pUiy m OMnn pan of game and Uha 
Mat it roosMuus will aojx-ai on yjuf 
viriso. 

P«t£*,95 Fre* 
0/a?di. dfwo^fl -5&p Otters 
+ n.5C IfftOsi iirtmr si Mtgic At} 



ZX-GLARANTEED !¥C) 

29 Chaddfltori Drkv*, Dnnvorlh. 

Bury. Lure*. HI J 8NL 



The Publishers take ail 
reasonable care lo 
ensure that classified 

ddvei ti&emidrs are 
genuine, bul readers 
must satisfy them- 
selves that they will be 
obtaining what they 
roqu re before entering 
into transactions, parti- 
cularly if thay involve 
large sums of money. 

IJ] o* 



Y OU R COM P JTEH , MARCH 1SS5 1«i 



BU¥1H CASSETTES 

ft.lv en n » pnjl sin «ii»Ii f 0- utw«n|r*4 I tf> qiallr ccmpuc* >*vdl> C*M»o*» *lflp«*1 val'ja 

Pwffi .>n<Ji(tff l/J r . pat fl £IS*in; 



L —-=!■) 1 l-i 


Bui Piic* !"W 


5 v,,-i j^.gi 


C4 15 


10 rtiirti it 101 


£4*) 


12 tint ■!: lii 


C445 


lfc*ll<Hl:,HjP 


C4S0 


» »•'"+ lf,»> 


pi JO 


50 runt 4C,6G< 


!'jE 


50 mini H .Mi 


CTWJ 


O.ir^.rfr /u.vl.j' f}V4.'ci L 1 ' 


Ll^tj HtF fl" 



Civ. 



■-..'•:- 



TRADE EH CU=R C^ W C -C OM= . vJE I B .E, r L '1 M L. SL H VIC L b »W:-U C 1 . B L * DM EC 1 I RCM 
WAkiySACTL.RFRi OP PROFESS IQNAl fflA*t> r*S5FtTFS 



ADDRESS 



PROFESSIONAL MAGNETICS LTD 



fOflji C50J. 3bmb«ii!Miju-.p. 3?9 Hi, 

FR=EPOST t.i irjsizi M*o* 





COHMDD0RE 64 AMSTRAD MSX OWNERS 

MIDLAND COMPUTER LIBRARY 



I Ai. it Liim Eicfci or zaisciia. Ji3^ 

J I ■ ' - ■■■ I . ■ 1'K'J i_ilI ii*1 

ntisfiLiulv Ir-eu 
3 I Ma nnmh-T*a.iip tfi flO 
.1 Hir« rniu.ji 1mm ivily ■" 1 lift pAa 

Pot'lii T d»tfi. 

L P-Jfi. I. Mil I4TR4 IHALIl i>" |bn^. 

V'J"! 1*^ lu-J 
6 All [r*"ltb JnijNWIt Mltti Ivil 

dKunKnciL-uri. 
5fina rArqutf ur 1 ■j«-i , j.' ■ ■ r lAtf ■ 'l. - f" rt- !.i you I wu AtntiiriLfii u" .'^>jc" S-Tf fdr ft 

Q MIDLAND COMFUTfcK LI&HAH^r 

TN fiTJl artt LnyiisE Cainmodpr** ^1 ihr:ny |r. thi? wOrW 
31 Fvnnlnili- Clrtiis, LiifUjj P.uk 
Rodtftch B9B 7N0. Tdcphono Q&2T Z35B4 *0 



T G*m *, B-.ilnim «<x. E*ui»Ulo r ifci 
wrtavarc. 

d r-"r" nFi n* pi"--?! -rtrinf* p.if^^it (i>i 
3* L.UWfci-1 ipWte I|*"J lilij UillrtJfiM 

l: iLda in lit 'Jtf. 
10 Jam now &*i rnanay lank 
p.iirjPiTW 



I Ht" u'cl«"i± v 




11985 VERSION! 



Would you like to transfer your i-pecium programs Trcm| 

© MICRODRIVE TO MICRODRIVE ©TAPE TO TAPE 

CD TAPE TO MICRODRIVE © MICRODRIVE TO TAPE 

Tier dc irwitJ' 



ii? 



! ^T tok 



The definitive role playii 



world's leadlnf author and the 

In your Hl^i Srree* shortly. \^^T lSTtRMAllOUL™ 
t5 New Sunmtr Stiw^, ffirmtnitham 619 3TE T*l: (U I -359 OBOI 



EDUCATION 

*h»rh*r it Ik SPECTfl JM. ZXBt nr BBC B, wu h«U ip Until piXsaMy Urn 

Ivgfnv ijpiu" lj-1 Bdj-ai-orni iohvAi* (vjii*bla, luiimtlv m »rc«u q1 

BO 3IFFEHE«T (?UC^TI<^^)A^, C^SSt~T(5 

ppjdu:«d &v it's msjo* lollwi'e t-ou«« 

SaE Top :ataopu* *na SPiHtAL OFFERS. Also SAMS TAPCS: 3 lor urma op j 

IKATDH. 1 2, =*rm»tl Ppiuc, HaUti i id^a Euan. IG4 SlU TbI. 4 1 - 55Q !-5?5 Ja* 



| TFfiNS-EXPftiESS is Mir ■■lrjsi c'jrrprrjrBr.si^o pickaga of fouf m.'L ulllliw. 'ui 
tpan^fer'hg Speccuni lfngsms frwy an U5tp frisndlv, sirrDla io usa, iHiaL > ft 
| mgpy EfPcleni. 

iHywil arEbleyogta ifjfisfwjlnv featfd4i programE'.p totha ; u -I -13.CK len^ph. 
I TAFE TO M.'DfllVE; wH *li£J lUpf n Nitll y, i' niKtSiar,, mDdify, resfpuclure ;iiri 
| *ein«ate both aAJIC and IV.'C 10 rup from m'drVai. 

V»u C4n Ouy a.iv o" ih« 4 pTOgrjrns far C5.53 or T/VF6 10 M/tJHIVI A\in 
| M/DRiVE TOM.'CRIVE locech* f&P fZ&O. or aUthB* p^>flfa-»is en a up.: Inr 
£E>.35 op an ■ m' drive capi idge fap f 14,95, 



MICRODRIVE TO MICRODRIVE 



INEWI . . . AvISTRAD wanton of TAPE TOTA'f J f * «* ply HF *" 

Tpanifan proE'ami of any length, ar.y speso, Ijudcluw, iftnlh lnici thrnfln « lifldas, 
lalt, Conlinucus LOAD.'SA/E. rcpaitod SAVE, Ml S^OH.. full heade*, 'Hadip. 
urppolcct. at:. 



Vjt* 



!H.Iilt I'vn.rvr, nr 



-r . .■ .1 IIVI., ---- lM ,J|t*l 



vi: 






lot; noa 



RETAILERS 



For fast speedy distribution service contact 
Drake Distribution on 0752 500951/2 



VfV» csn ctfer »ou- 

- 2*-heu' d4W«vin LK 

' StinW Mflfl *v4'lpbl',' 

- A' i the 4tcn »l:wt»n 

■ Peieiuf^dthlvchHivirvamtaB tpwcuiflhtmi nin 

■ B**SPt *nqutliii Mfileorne 

■ JS- Hou- dtfi^'epv mi b« wfl ns f(j 

A; PtUJilys tjl PSi)l\clS »Vt> 1l»llW 1-rtJ lltea llu« !*rl| 



Plwiflo* wnle I i)i ii |ipilim iftl ikvh 



DRAKE DISTRIBUTION 

Unit 45, Enterprise Plvmouth, 

Semereet Placa, Plymouth PL3 4BB 



u« 



* BACK-UP SYSTEM FOF * 
"C.aM-64 4 VIC -20* 

Tnn DACpC Uf BO*PD >» •■Uk ,.i. I 
tai(E»t. Linn |i-csr j 1 iq j™ wjy m |iin:l 
up vi:ur 'ape' prcgrapni. Wnf Ihl 
bpjjTti vou Can OT" "eel u sittww. CBH 

LlJ^u ">:^k Pfp vuu: Lonipijil^i V-u< MP 
CL'pv * p'efl'aTi or 1 1 1 1: '.i'ciimI dMk 
Mrn U i! kn5* :r O'Ti if i' In ii Veil c=Ti 
bick l.fl nr/eeice, lurOu 1 1 1 H'Jr-i ■. da' a 
fi^4 *({:, This BVirl^ HI ' ^' h^rt-i n 
piOflff PTiS lhal VOLI' I |i' l'.1.''rfl top:*T 

inf. 1r> Iftri Id do 

BACK- LI? BOAfiB for 

"RPu 1 M 1- W" j":.i 
TRIGSOFT LHiliraMf 
J6 Ripon Stpr>ol, Pmlmsin Line, 
HaliiflK, Wes: VoihsJ-iire HXl iUG ta 



BASK; F-flCGflAMWING COURSES 



rn«TifM;ri>p im f'J'iii^HTj-i?-' j^iiin H^S [! 
p/oj-rnpur.i-nQ [Hj naal idleetivij wav 
with gjp iorrr i.udy or cuff!rj 
pondaftp cjjpsyi frucpiiiinTirvi trA'N 
NOT be le-Li'il Ii'jit 'U-.-r t^ri t iii i;.*:; 
a!o'-:f Our rivi".!- h ■- ■ !i • . ri-| h ,r - 

ty..Jj ■111 L-- UP'-'JUK • '-I i Llll, I: :! i! ll(. 

ijls'ij cOi 1 !!'!; AL . iispn.-1-^y <V Hinmfl 

L'OP! Pll|il'!|, * ■' ; '» !H'1J V'll '--'J -.1^1.1 K^f. 

ii i ' i : 1 1 1 : i i ■ «. ■ I . -. i ■ -: ' - 1 A ■-. ■ .i I 

^| i,! Ii .mi 1 1 .mii ■ I nJv ■ : i.i ' ? i ' '■ ,9G 
cop puiipfnnjiisic* conisfi IncJ. 

CCTlllCil'U Wimi pil^aiHlJ (4aii. 

RI0LEV, Dcpl. VC, 
V^ All SEND HOUSE, 
PieVh^SEYBfl*. SUSSEX 5* 



TECTEL ROBOTICS 

CONTROL BOARDS FOR HOME COMPUTERS 



one 

one QUUBRy tl4 

1 cf IGrharnd coidHjUtT 
ORlC ADC 1134 

EuporfaDt 9 --.-n-..:-l 4«WiD| ■:■!) '--I 

M':flnnar, 6 til latslj^ior 

l>Hlf: l-Q |:oi1 [J3 

lifi iiriBjianiTiahlf rh;-in-r. . 

pj^ip.: PltUTEA f*G 

?4i i.ir. i-.ilM. ^il(:liic-, cm. I- f E r'd 

pnrl. it* &fiirb[firS. 



ZKQ' 

15(61 l3UUD)lf C2i,SO 
I .,■ S ■ ;.!"■ I ;rn l< 
>)« ACC C3i 

Iup^ff#tl G ^j-wvj" arjVsfl 

etan.-MH. 9 tnt -cirJulicn, 
ZXBll.'Otion C3< 

'C p-ogr;"rirTnb1o cKamors 
i.-..ei H|.=iE50LL-|Cr.' 
T :R.\FHI=CS C2S 
,pl n - ir p i et jI: =■ . 



:<'«i1j 



I T r.X 1 SOFTtA/ARE u new ran jo ol Ddiicaticnol pfograms. 



TODDIERS Iprr ^rhn.ill 
LEAPNvuu' AL^MAKM 
LE^.p*^xu tUUriT 
LEARN you- CG.OJJ.S 
LE^R'Nyoj- 5H»PEE. 
AEOLTincHDUSE 
A.EOUT Hit' KlTCHEf: 
AEOL'T CLCTHS 
F3.35 tael- 

Rfinrt f.hfif|iiR nr PfWJll Otriflf trr 



V1UMS SU'DS 
ITCXE cn7<honk lEtgfiitii 
lltJtl e0$UWR KrfrWi} 

rTEXr KfijktiMK <>tai:anl 
II >l i ■ M;- - '(i-iiam 
TEXT Wne & Btti Mrkng 
TtKT C< u *iJL.iH. OnsHis 
TCXT CioklKfly ConftttiJfl 
5 t:n ivi.l- 



TECTEL 

Telford Opportunities Centre, Haksfield 14, 

Telford, Shropshire. 

Tel. G952-58173B 



PttP£*-.S&i& t&itnlbakYdtt} tot ii»t 



«i i? 



ICOMMODORE 
SUPER BREAKER BACK-UP BCARD 
For the Conrmnodofe 64 and Vic 20 

wi.oit i $«onri CAM typs r.«s»oitn unit ii con net fed to vm t-wl it *t\n 
mnkn bnc^-up copies of «*s-iett* liassd sof.wa'o includiivg tuibo.'fasT 

luuUuU, B+?il oinJi'ui lllo^i-ilii uvJl- aitd tiMO '>1«V- fH«ftri dt TO. SO r*"a 

503 pip UK Eupspc add f 1.O0, qImwisk ad.1 C2.00I. An cpiknai 
RESET SWITCH ■rin nlsobn fiitmi for ortV £2.00 flwrfl hcltsiv*. S*nd 
eh*ou#/'P0 ar itamo far f j|l ceiat-s tot 

C. KENT, 15 Bamburg Clow 
Danashulmf , Cgrby. Nsrthants MM ir SPA 

iCOIvllVIODORE 



U4 YOUH COMPUTER, MARCH 1985 



.liij 




|fOI» n....ii i-li.il HA.CX !.]•• DptH ittih OU MKOfflJ ywxtM'W copi«r 

p*G<B*jt It", i. hfeMgM Krtu-lkty *tlf¥ftt»»rrtJ. +B< SfECTHUW Ort*|. 
J OGBte wilr* *S',I Ia;itl.!i!: - Hirnfrm <nun In nri'ifiil •'.j:-<-<.'i Mr iI - i'.t r'jnr, i.ir 
' LOADS in 1 1 ri i. ) I n 1 1 1 |UT:. CfJN I INLJIIUHI Y rvni whwt I inn: i«i iinNij.jlul i|. p, 

sh.DT If.'e ltsiil«-l. I: il:'i|,il 'ii';»l>:rri mc, rrvkiny Mir: | :rSsi wnpk; m ■ :l 

or'«Ct^E> USH fiul'ill*. 

' Capes wlih i. loig pingiaiii iiay t&OOJ * Uyieu. 

' Ewn fwtur?5. a.g. integral hEa-dar reader, nauip, r1»?lft aboil, ihpsil copitf,.. 

FULL maijal. 

" MN.T^EG '.VlfG - sslra Dreg'STi tnnsrg-5 Biftfii, Codi ■ arrays dir'itly tn 

in'Uivu r vtim fuiuin, 

TCBt6s:s Lfr. \Hi villi M I ti in :;ir--.i: Linn! M T I, 'H u M t ,.r.jlr l.|,r I- 'I: J 
CLUtuniBri olfltBB" - Ss^LCul ti rofljtron (T. afcs^o orient. 1 . 



MIC KO/WAFA/ DISC DRIVE 
TRANSFER 



drivrji g^in 
1(1 BfOBmill. 



NOV/ trinittr 'ho 
i inoill WEH LOW 



1SK S[T*<ll 1 1 ni rWiDiN wih Mn-jm. V\\*. i .• I 
MlUfJWI T IK Illhr firO||'ii»i!|. lift ruiulnrlrrazi. 
MkllHIIhM HL1V 'W3S4J. 

In MiitJw from lope yen fT^jt esnwert thrj p<D£jr8fi, «"id tfujn [rimttf "hi 
i"iM"Mlirf Liv m VltJl (of iWFJll fi(t* & (naorjrttti a'/Wry you (fit totfl TG do L h« 
niih iiiL-uiitjiis to |m intm ruir-irif] wrjl umg fiun rivp CA - " nsUMKGBp no 
ic ■ .M. mji.'WDI rm-n ci t.trp onhui-iiivs imnnuii wiih tiamola finilin ino 

nii-n i'j-i 

TMftwIlMy rMcMned ]ro>jiiim fcuii Veur Sdu«. Nu B P14I is ESSENTIAL if,veu 
■fir (*)k*t Ihj E .i-i&kri WOy 1 hj' tbui ^L*aiHii.-, lu p-ijui iJivu. WP1 i,yV£1 Tg -Jia:. <ji 
'.v.i in i ■ v.i ■ i-L-.-i.-i-i- 1 1,--. .1 — -i-in i h s:i 

ALL PRODUCTS 1 A HP. Y OUR MONEY BACK GUARANTEE 
DVhHSEflS; aid f I EurofKi, F2 flUrar Ten Bisch prtiruel. 

6A.ET fv* l inui in* 



LEHH, OiPTYC ID BRUNSWICK GDNS. CORBY 

notmvuni 



J4S 



MICRODRIVE BACK-UP 

"THE PRINCE" 

TrattsferaaHuSimategcm* -.-■■ i.r-h.-Jn. i U 'i;: w.::r.:.i' hi ■] Kt.i'ihi Lore" 
tTBitsfea Decetbknt", Cyctons', C3ra;hus.:'iiE". I, i : nyi", 

M" :■ v -u-. !■.■■ ".'■; •■ :i ri . Mat', fflKhtnan'", 'tygu&Aittftk", 'i-rco 
.■I-. ■ 'Checjfz-irxt [Jac. i>osf ini'.r.-in-. games and mani) nkue 
A.bGQlutPlv i. i.-iiKri'eid :d wni:! ln^jedibLrj fSlua *! LS.ffi 

CSiWylft* fri M AV^^nrJwr AlnranHpT TVrirnpiTtinj SysteiTii, S'i Laps- 

down* Lane Chariton. Londan ZE1. 

Alexander Coirputing iyslcttli 1915 



A 




MlcroflfflSd 


as 


Addictive Gam$$ 


e? 


MIcronelBQO IS. 1 


Amsliad 


74, 75 


MlHrijUBn 

Mil ci. Ben ci So't wac 


M 


AnnOfl 


iec 


ti 


Amhcny Asnpatei 


vj;- 






Aigus f*res& So'twar: 


33 


N 




I 




Naiional Soflwae Lbra'y 


w 




National We;tm n&tcr Bank 


-9 


Barclay card 


ID. I 


New 3erera:ion Sollwa'e 


70 


Bsnbuq 


M 






BeU-t.wll 


1 36 


C 




Bugbjln 


1F0 


CMl* Sef;vwjrc 


:s 


C 

Canon Film Distridulors 




Ccean Games 


ec 


73 


rr p^n Software 


8,9 


Cumanfl 


ta?,tas 


P 




D 




Philips A Ph lips 


J6 


DkCC 


64 


Ficltresque 


10 


DKTronics 


m.f^ 


Fitfn*n k.'-'uk-. 


40 


OBimlaon 135.137.139 


FtotcK 


138 


E 




Q 




EiHo System* 


4.5 


Ouidt&Mva 


12 


F 

Fiel Ltd 


28 


R 

USD Con nest iona 


117 


a 




3 




Games Workshop 


62,63 


SMT 


Ut 


G Ison 


117 


SagaSyilaffls 


136 


H 

H sof' 




Sol o; Seftwaro 


30 


146 


Shurd Sofluare 


30 




Sinclair Research 6, 7, 13-17, 


1 




Software Comer uni:;g,li 3ns 


73 


IMflO 


30 


&ofr^are uwran 


34 


lfcen:tveSatlwa'£3 


43 


Swan ley 


70 


InctuslrialProcBaa 


34 


Swesco 1 


22 


Inn^lr-r: 


64 






Interface 


58 


T 








aanan 


118 


K 




The Wicowofkshop 


137 


Kr.rnr?hscft 


116 


"~hQ.uqhtE LCrosnn', 


32 


Kuma 


49 


"ostiilM 


61 


L 

Ifil 


SB 


U 

UC Gold 3G , -14, SO, 30. ^D. 


Llamasofl 

M 

Uirm i 11 an- Knf f wjiaf£ 


96 


05, 131, 134 


, 140 


m 


V 

Visicm&lofie 


24 


Metacomco 


109 






Moroprice 


120 


W 




MicroX 


22 


WIHIafTiStoifl 


56 


MltrutinswHrs 


lie 


Wizard SoftiNara 


56 



SELLlFwiTH 

mm 

COMPUTER 



CLASSIFIED 



ORDER FORM 



Classified Rate; 

Linogv: Up p*r word (Mil 3U wardi) - 


Please Insert me fo lowing advertise Tient In Your Computer Classified Section 




l«(X» odvftinri ihoufj conpfwt* rl^# t&rrr\ 

pipuijVtf in 9(3Cff ^ff'^li. PBp.ff miTbwr 










.IN AGE 




t*v*H 9i 7 **?&*. Warn* **a trii'rit H> *• 

Dliplo/ ratat pm tet i'm .r -J- ■ -- 1 
Oi-h lnHr*HM [f.M 

Three minnioni 1S.7C 


































£10,00 




T*iL«mncioni ; I1.0C 

1 )■■■■! l,\t..ttvitri<Mr: insult frew/fto ">«w«#r 












£1250 














115,00 




Method of Payment 

Chcquei ois, ihsulc frc pqco payable 










f17 SO 




to lullntu Prin intB-nartlenll .Id, ino 
£i«l**d. 1 irKkiH h*f«wth 
ch«que>POiOr 

£ 










£20.00 








| 


£22.90 




P ioo le dobil m v Ac cuis.Vi id BO' Ci Ov 
Ca idi'AiriH ri^cm E xpithis.'Difi'eri &U6 Kt' 




i 


£25.00 






No, of insertions required |~ ]8cx fso. required YES/NO 































SlCN4'URi 



NAME fftuflw mtloffr.rarietbl 



AD0«5S 



Po*t to: 

C.it out hb order for n - an^ ttu'n 
rttjjnhiir with tDU' rfniiTiixt to: 
Chi i^ Ffiqii Oeparrnpfl. ic, "i'vy Cumuulifi. 
flw H211 Hufldran.! HouW, The 
Qualr»n:, Sucion, Surrey JW2 )AS, 
I0l'«l KB6 



Pay rr e nt by credit cq rrJ p tease state a c dress card Is registered 
DoytiTietel.no 



THIS FORM SHOULD BE RETURNED BY FEB 27th FDR APRIL ISSUE PUBLICATION 



CemptnY AcgiSTrvc, Nuntw ?ir?W/ <t»q>in<!i HeqKtettlt One* UttJrfram Htiiie, fid Uutslrrnl. $ut\$n, Suttry Sltf SAS 



YOUH COMPUTER. MARCH ICrj.5 115 



Hot* 
lines 

Acorn Computers 

TcluphoiH Carnhridcs 0123 2101 1 

Atari 

T*l*ph<J1S- SlOUfltl 0*53 14591 

Arnstrad 

TelEphone: Brentwood 0277 22&BE-B 

Commodore CBM 

TtI.vjiui- N'j.1U*.hj1l-ii CSS* 203*3? 

Enterprise 

T»l«plMTfl: 01-730 aasa 

Oric 

T&ltphenr Cambrlttge 02205 51 -f 

Sinclair 

Tdieptroie: CamhrldtO 0(715 flBM'1 

Tandy Corporation 

Telephone: Birmlnghifn 621 JMS101 

BJTlJS 

Toshiba 

Tel«phonis Camb*rt«y 0270 Q12S2 




Local., national and 
international micro 
events are updated 
here. To publicise 
your event, pnone 
Paul Bend on 
01-661 3472. 

Scottish 
Computer 
Show and 
Conference 

Takes plate Mara 1 2- 14 at the 
Arderston Cejuire Tlic Albany Hotel 
and th: Halidiv Inn, Glasgow, Trade 
Show j co^crir.g the tig toys jts -ivdl 
as home miens. TicLers are readily 
aviilahlc fron - Cjhncrs Exhibit lahk 

Lid. Telephone C6J-332 4242. 

Computer 
courses 

Hilton Irsicniitio.ia! Compu tr 
TiaininR Ltd are amngirtg courses 
iiJmoJiy pivmlc uu .iiUkuJuUiuu lit 



«. - 




t 





f Sq t said to tuetr. th's ii A 
wtnt yvu can do witttyoni f 

lortpary 




L_ 



JcTl;^ Trettuiei rrjakus a 'trw pymitriJ retniuks about tiia (anrer 
company, Commodore, ntff'tef <imijttsnoousiy indicating the 
direction he expects Atari profits to takdnow that *ie ,'s in charge. 



computing Tor ftut.ilki. Oust is 
:ibnui £1 1 .SO tier pi-rs:in, und 
ilOLltcllI iilLludp;. L.'iitif.iiisfn;!, oi ;■ 
micrft. buying on* and ih* fu:urc of 
computing. Tc be he] J on 17 un<] 

II Match, and 14Apil at 
Clarendon Hotel, BlacklKath. 
TcIcptiiHic 01-352 2*=9. 



INFO 



INFO lakes place from March 
26-2S at Oljmpia I ondnn. Op;n «a 

tiie public. Son*? fTUtrof- but ivoilly 

hip stuff. Telephone BED 
Exhibitions, Willi ttgtoiu Surrey 01 
tyn 1001 for mure ictvib. 




ILfiMIT 



£9-45 

The most powerful t&oMt ;>et for ZX BASIC. AS tht faturts 
ycu will evtr need, AUTO insert, fuU REKUMBKR, Hock 
DELETE, CLOCK, ALARM, trror tripping, br&k 'ranatng 
bait VHAVH vti'h iingie-tttp tnd mush, much mor;. Makes 
ZX BA S/C easy-to-me and powerful. 




£14 

Aa excellent astemblet, at. advanced Une-e&tQt, a compre- 
hmsirc disaaembhr and a superb front PtntV icbigger 
at: in one pattest, Utei bv ttttrtv leading Software houstn to 
write their games "buy \t! Adon Deniiru; 1994. 






1H Hgh Sjfi+i ftonn 
Dur.nb.1t. Bfdi. LUfl I AT 

-«k»se3(es&«2 



£25 

A powerful and almost full impltmentafon of Pascal ■ not a 
Tt»y Pst-al A valuable educational and development tcol, 
program typically run 40 times faster thes a BASIC tquivslmt. 
Spectium version inctuaes Turtle Urcphtci packafe. * I haven 't 
seen any other compiler hat cculd Tnttch Hiiofi's tasal" 






for the ZXSpectrum 

Htioft is pleated 'o announce a rtc-w compiler for this popular 

and effective eyitemi programming tanguags. Jfift a iiizy-Cbuf 

an extensive. ea;y*t<f*use mpiamentaiion of thf kngvage 
Allows direct execution of compiled statements. SvppFed «eitf. 
fitrrtinti lihmy Avail/Thle direc: frr>m ttisnft for tl>, r>r writr 

for further details. 

Allptirtt. UK delivered, retete to 4SK ZX Smctmm \erwns. 
On* ttfrmare is a-aHabk fer »va*t> other 7.S0 micPitHtt c^. 
Amttrcd CPC 464, MSX, Memoteth, SHARP MZ7Q1, ,Vew 
Bnin, CPfifeie. Please wi:e for detiils. 



J 



146 YOUR G0MFUTER. VIAfiCl- 1935 



FAST AND FURIOUS 





ALL ACTION ICE HOCKEY 

SLAPSHOT from Anirog is a two player, fail aclior., ice hockey program Also 
in this thrilling: game there is included a smoothly running speech synthesis 
i, >■■ i-Umj j uf Uiu* vuty liijjlit'iL Lj^aJity B jfoit Hie actual gmie &tAita each player 
must selec; an international hockey team to represent. After dihr.g this you 
must quickly and skilfully manoeuvre your ilmr a or* ss the ffl i s t e ; x i r^ y: ice 
whilst your other team-ma.es mnve automatically arour.d the rink waiting for 
you to pass the puck to them. If you do manage to race pas', the opposing defence 
then you have a chance to shojt for guiil and score. However, you at. 11 .lave ,he 
goalie to heat who is abb to dive in all directions. Also ".ncluderi in tills 
ft.maz.ngly quick and Totally original game is the ability :,o actaa.ly physically 
bodychesk your opponents Never :he legs, dc not be too aggressive otherwise 
you could incur a "rou,(jhinjr penalty", results tip in a faceoff in your avrn end. 
giving the opposing side an easy chance o: storing. Also ether extra features 
available include: Pause moce. and three levels o: plaj ranging from fast tc 
slow as we!l bs a re- start option. Si upshot Iron Anirog is a :o I Lilly original twe 
player game with lightning fast iction never seen bBforeontheCommudore&4 

Two J.S. Commodore 64 Cassette £8.95 Disk £10.95 

Triidn Fr\enwri»s ANIROG SOFTWARE LTD. UftIT 10 VICTORIA I NO 3 ARK VICTORIA ROAD DAHTFCflD KENT (0322)92513 
Mini Ordci: H HIGH 5TREE1 HDRLEY SURREY 24 HOUR CltEOlT SA1ES HORLEV 02S34 6063 




/B 




Gif 

Type: Arcade id venture. 

Computer: 5p?etrun 
4AK. 

F>rniHt and price 
CasscLle, £S95. 

Publisher: Ocean. 

In brief: Classic romp. 

AN epk adv re to 
^challenge ' Aate's 
recent rei" Jfrcfited 
by a gr >f former t 
Irnagir ^famnefs. W:M 

Sp ji anci ent of 
O" yu has you con- the "^ 
j& Orestes in a «• w 

of a a under- ^'^jl 
d labyrinth to ^ ^ 
and collect 12 mm*? 
pes familiar from Gods, a 
idean geometry. «• *** 
,'elp comes from the l ^Pf 
epirit of Electro and 
hindrance from hm 
Clytemnedtra— your ,^ 8 
moihcr, no less— who Int. lt b* 
steals shapes an 
makes a nuisance 
herseir. 
There are also 



leaver 



hO k*r, obuinT 
id tas" wbo'M 

of Jkr-\ , 

. . It-iildbcKi 



snakes, spiders, three- ' 
serpents, 
ulfs 



headed 
spitting ak 
other horrors 
with. 

Likely to be the first 
big hit of I98o. 



s end 
to d?al 



jctniicilf 









a **>»~*l» u f 



&*■& 



i 









Qt^ 



c^^^rc 



Q C e^